Data Export Date: 28 Oct 2007
This section describes the network objects (logical and physical) that are referenced in this technology pack's data model.
ATM adaption layer 1 virtual channel termination point
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the AAL1 interworking function in a circuit emulation in UMTS network. | STRING | |
| Name | A user-friendly name preferably unique for the AAL1 TP VCC TP | STRING | |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| RNC | RNC in a UMTS network | STRING | RNC |
| Network | Network associated with the AAL1 TP VCC TP | STRING | Network |
| Region | Region associated with the AAL1 TP VCC TP | STRING | Region |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS). | STRING | |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Vendor | Manufacturer of the equipment supporting the AAL1 TP VCC TP | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the AAL1 TP VCC TP | STRING |
Access Point for the ATM Adaption Layer 2
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all AAl2 Access Point performance data | STRING | |
| Name | A user-friendly name for a AAL2 Access Point | STRING | |
| Region | Region identifier | STRING | Region |
| NodeB | NodeB in a UTRAN network. | STRING | NodeB |
| RNC | RNC Id in a UTRAN Network | STRING | RNC |
| AAL2_SP | AAL2 signalling point id relating to this access point | STRING | AAL2_Signalling_Point |
| Node | The Region containing the AAL2 Access Point | STRING | MGW |
| Network | The Network identifier | STRING | Network |
| Version | The equipment version | STRING | |
| AAL2_Access_Point_Type | The type of this Access Point | STRING | |
| Node_Type | The type of node to which this AAL2 Access Point is connected | STRING | |
| Technology | The technology associated with this aal2 access point (e.g. 'GPRS', 'UMTS' etc) | STRING | |
| Vendor | The equipment vendor's name | STRING |
Signalling point for the ATM Adaption Layer 2
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all AAL2 Signalling Point performance data | STRING | |
| Name | A user-friendly name for a AAL2_Signalling_Point | STRING | |
| Region | The region identifier | STRING | Region |
| Node | The Node to which this AAL2 Signalling Point is connected | STRING | MGW |
| Network | The Region containing the AAL2 Signalling Point | STRING | Network |
| Node_Type | The type of node this AAL2 signalling point is associated with | STRING | |
| Technology | The technology associated with this AAL2 signalling point (e.g. 'GPRS', 'UMTS',etc) | STRING | |
| Vendor | The equipment vendor | STRING | |
| Version | The equipment version | STRING |
ATM adaption layer 2 virtual channel termination point
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the AAL2PathVccTp | STRING | |
| Name | The user friendly name for the object | STRING | |
| Region | The region associated with the object | STRING | Region |
| Network | Network identifier | STRING | Network |
| MGW | mgw_id | STRING | MGW |
| Vendor | The equipment manufacturer of the object | STRING | |
| Version | The hardware/software version of the object | STRING |
ATM adaption layer 5 Virtual channel termination point
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the AAL5 interworking function in a circuit emulation in UMTS network. | STRING | |
| Name | A user-friendly name preferably unique for the AAL5 TP VCC TP | STRING | |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| RNC | RNC in a UMTS network | STRING | RNC |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Network | Network associated with the AAL5 TP VCC TP | STRING | Network |
| Region | Region associated with the AAL5 TP VCC TP | STRING | Region |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the AAL5 TP VCC TP | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the AAL5 TP VCC TP | STRING |
The logical interface used by Asynchronous Transmission Mode technology.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the ATM Port. | STRING | |
| Name | A user friendly name preferably unique for the ATM Port. | STRING | |
| Node | A unique identifier for the Node. | STRING | MGW |
| Region | Region associated with the ATM Port. | STRING | Region |
| Network | Network associated with the ATM Port. | STRING | Network |
| ATM_Port_Type | Type of ATM Port. | STRING | |
| ATM_Port_Version | Hardware/Software version of the ATM Port. | STRING | |
| Node_Name | A user friendly name preferably unique for the Node. | STRING | |
| Node_Type | Type of the Node. | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS). | STRING | |
| Vendor | Manufacturer of the ATM Port. | STRING |
Traffic and QoS parameters for virtual channel connections.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the AtmTraffic_Descriptor | STRING | |
| Name | A user-friendly name preferably unique for the AtmTraffic_Descriptor | STRING | |
| Network | Network associated with the AtmTraffic_Descriptor | STRING | Network |
| Region | Region associated with the AtmTraffic_Descriptor | STRING | Region |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the AtmTraffic_Descriptor | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the AtmTraffic_Descriptor | STRING |
Plesiochronous Digital Hierarchy interface (2.048 Mb/s)
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all E1 performance data. | STRING | |
| Name | A user-friendly name for a E1. | STRING | |
| MGW | The MGW to which this E1 is connected. | STRING | MGW |
| Region | The Region containing the E1 | STRING | Region |
| Network | The Network identifier | STRING | Network |
| E1_Type | The network element type | STRING | |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
Devices used to cancel the echo effect of 4 wire and 2 wire conversion in the PSTN
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all Echo_Cancellation performance data. | STRING | |
| Name | A user-friendly name for a Echo_Cancellation. | STRING | |
| Network | The Network identifier | STRING | Network |
| MGW | The MGW to which this Echo_Cancellation is connected. | STRING | MGW |
| Region | The Region containing the Echo Cancellation | STRING | Region |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
The Internet Protocol over Ethernet link
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the Ethernet Link | STRING | |
| Name | A user-friendly name preferably unique for the Ethernet Link | STRING | |
| RNC | RNC in a UMTS network | STRING | RNC |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Network | Network associated with the Ethernet Link | STRING | Network |
| Region | Region associated with the Ethernet Link | STRING | Region |
| Interface | IP Link in a UTRAN network. | STRING | IP_Interface |
| Ip_Protocol_Layer | The Ip Protocol layer associated with the object | STRING | Ip_Protocol_Layer |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the Ethernet Link | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the Ethernet Link | STRING | |
| Ip_System | IP System in a UTRAN network | STRING |
The Fast Ethernet interface on the General Processor Board (GPB)
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the Fast Ethernet | STRING | |
| Name | A user-friendly name preferably unique for the Fast Ethernet | STRING | |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Network | Network associated with the Fast Ethernet | STRING | Network |
| Region | Region associated with the Fast Ethernet | STRING | Region |
| Plug_In_Unit | The Plug_In_Unit associated with the object | STRING | Plug_In_Unit |
| Node_Type | The unique identifier for the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the Fast Ethernet | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the Fast Ethernet | STRING |
The GigaBit Ethernet interface on the Multi Function Gigabit Ethernet, ET-MFG, board
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the GigabitEthernet | STRING | |
| Name | A user-friendly name preferably unique for the GigabitEthernet | STRING | |
| Plug_In_Unit | The Plug In Unit associated with the object | STRING | Plug_In_Unit |
| Network | Network associated with the GigabitEthernet | STRING | Network |
| Region | Region associated with the GigabitEthernet | STRING | Region |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the GigabitEthernet | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the GigabitEthernet | STRING | |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING |
Inverse Multiplexing over ATM; transparently multiplexes a single stream of ATM cells onto one or more physical link.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all IMA performance data. | STRING | |
| Name | A user-friendly name for a IMA | STRING | |
| MGW | The MGW to which this IMA is connected. | STRING | MGW |
| Region | The Region containing the IMA | STRING | Region |
| Network | The Network identifier | STRING | Network |
| IMA_Type | The network element type | STRING | |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
The application which provides informative messages regarding network and service conditions.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all Interactive_Messaging performance data. | STRING | |
| Name | A user-friendly name for a Interactive_Messaging | STRING | |
| MGW | The MGW to which this Interactive_Messaging is connected. | STRING | MGW |
| Region | The Region containing the MSC | STRING | Region |
| Network | The Network identifier | STRING | Network |
| Interactive_Messaging_Type | network element type | STRING | |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
The Internet Protocol over ATM link. LLC/SNAP encapsulated packets over Atm Adaptation Layer 5, AAL5, ATM PVCs are used
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the Ip Atm Link | STRING | |
| Name | A user-friendly name preferably unique for the Ip Atm Link | STRING | |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| RNC | RNC in a UMTS network | STRING | RNC |
| Interface | IP Link in a UTRAN network. | STRING | IP_Interface |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Network | Network associated with the Ip Atm Link | STRING | Network |
| Region | Region associated with the Ip Atm Link | STRING | Region |
| Ip_Protocol_Layer | The Ip_Protocol_Layer associated with the object | STRING | Ip_Protocol_Layer |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the Ip Atm Link | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the Ip Atm Link | STRING | |
| IP_System | IP_System in a UTRAN network. | STRING |
IP Interface for the SGSN or GGSN.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the IP Interface. | STRING | |
| Name | A user friendly name preferably unique for the IP Interface. | STRING | |
| Node | A unique identifier for the Node (connected to the IP Interface). | STRING | MGW |
| Region | Region associated with the IP Interface. | STRING | Region |
| Network | Network associated with the IP Interface. | STRING | Network |
| Node_Name | A user friendly name preferably unique for the Node (connected to the IP Interface). | STRING | |
| Node_Type | Type of Node (connected to the IP Interface). | STRING | |
| Mib2_if_index | Index of the Mib2 interface. | STRING | |
| Mib2_if_name | A user friendly name preferably unique for the Mib2 interface. | STRING | |
| Mib2_if_descr | Description of the Mib2 interface. | STRING | |
| Mib2_if_type | Type of Mib2 interface. | STRING | |
| MTU | Maximum Transmission Unit of the IP Interface. | FLOAT | |
| Speed | Transmission speed of the IP Interface. | FLOAT | |
| Physical_address | Physical address of the IP Interface. | STRING | |
| Technology | Technology of the network/element (e.g. GPRS, UMTS). | STRING | |
| IP_Address | IP Address of the Node connected to the IP Interface. | STRING | |
| Subnet_Prefix_Length | Subnet prefix length allocation. | INTEGER | |
| Interface_Duplex | Interface duplex allocation. | STRING | |
| Interface_Version | Hardware/Software version of the IP Interface. | STRING | |
| Vendor | Manufacturer of the IP Interface. | STRING |
The IP protocol layer with IP forwarding functionality
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the Ip Protocol Layer | STRING | |
| Name | A user-friendly name preferably unique for the Ip Protocol Layer | STRING | |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Network | Network associated with the Ip Protocol Layer | STRING | Network |
| Region | Region associated with the Ip Protocol Layer | STRING | Region |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the Ip Protocol Layer | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the Ip Protocol Layer | STRING |
The Medium Access Unit (MAU) represents the Ethernet transceiver function on a General Processor Board (GPB)
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the Medium_Access_Unit | STRING | |
| Name | A user-friendly name preferably unique for the Medium_Access_Unit | STRING | |
| RNC | RNC in a UMTS network | STRING | RNC |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| Plug_In_Unit | The Plug In Unit associated with the object | STRING | Plug_In_Unit |
| Network | Network associated with the Medium_Access_Unit | STRING | Network |
| Region | Region associated with the Medium_Access_Unit | STRING | Region |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the Medium_Access_Unit | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the Medium_Access_Unit | STRING | |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING |
A reference object used to group various media stream devices
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all MGW_Resource_Pool performance data | STRING | |
| Name | A user-friendly name for a MGW_Resource_Pool | STRING | |
| MGW | The MGW to which this MGW_Resource_Pool is connected | STRING | MGW |
| Region | The Region containing the MGW_Resource Pool | STRING | Region |
| Network | The Network identifier | STRING | Network |
| MGW_Resource_Pool_Type | network element type | STRING | |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
Media Gateway network element used to modify speech, data and protocols in the connectivity layer.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the MGW. | STRING | |
| Name | A user friendly name preferably unique for the MGW. | STRING | |
| Network | Network associated with the MGW. | STRING | Network |
| Region | Region associated with the MGW. | STRING | Region |
| MGW_Type | Type of MGW. | STRING | |
| MGW_Version | Hardware/Software version of the MGW. | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS). | STRING | |
| Vendor | Manufacturer of the MGW. | STRING |
The instance of MsDeviceGroup represents all devices on one MSB.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the MS Device Group. | STRING | |
| Name | A user friendly name preferably unique for the MS Device Group. | STRING | |
| Network | Network associated with MS Device Group. | STRING | Network |
| Region | Region associated with the MS Device Group. | STRING | Region |
| Plug_In_Unit | The Plug_In_Unit associated with the object. | STRING | Plug_In_Unit |
| Node | The unique identifier for the node this object is connected to. | STRING | MGW |
| Node_Name | A user friendly name for this node the object is connected to. | STRING | |
| Node_Type | The unique identifier for the node this object is connected to. | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS). | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the MS Device Group. | STRING | |
| Vendor | Manufacturer of the MS_Device_Group. | STRING |
Pool of all nodal devices of the same device type under the Media Stream Processing object
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the MS_Device_Pool | STRING | |
| Name | A user-friendly name preferably unique for the MS_Device_Pool | STRING | |
| MGW | The MGW associated with the MGW | STRING | MGW |
| Network | Network associated with the MS_Device_Pool | STRING | Network |
| Region | Region associated with the MS_Device_Pool | STRING | Region |
| MS_Processing | The MS_Processing associated with the object | STRING | MS_Processing |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the MS_Device_Pool | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the MS_Device_Pool | STRING |
The Media Stream Processing object in the MGW
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the MS_Processing | STRING | |
| Name | A user-friendly name preferably unique for the MS_Processing | STRING | |
| Network | Network associated with the MS_Processing | STRING | Network |
| Region | Region associated with the MS_Processing | STRING | Region |
| MGW | The MGW associated with the object | STRING | MGW |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the MS_Processing | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the MS_Processing | STRING |
MTP3B Access Point
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the MTP3B_AP | STRING | |
| Name | A user-friendly name preferably unique for the MTP3B_AP | STRING | |
| Signalling_Point | The signalling point associated with the object | STRING | Signalling_Point |
| RNC | RNC in a UMTS network | STRING | RNC |
| Network | Network associated with the MTP3B_AP | STRING | Network |
| Region | Region associated with the MTP3B_AP | STRING | Region |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the MTP3B_AP | STRING | |
| Version | Manufacturer of the equipment supporting the MTP3B_AP | STRING |
MTP3B Signalling Route
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the MTP3B_SR | STRING | |
| Name | MTP3B_SR | STRING | |
| Signalling_RouteSet | The signalling routeset associated with the object | STRING | Signalling_RouteSet |
| Signalling_Point | The signalling point associated with the object | STRING | Signalling_Point |
| RNC | RNC in a UMTS network | STRING | RNC |
| Network | Network associated with the MTP3B_SR | STRING | Network |
| Region | Region associated with the MTP3B_SR | STRING | Region |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the MTP3B_SR | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the MTP3B_SR | STRING | |
| MTP3B_SP_Id | MTP3B signalling point. | STRING | |
| MTP3B_SRS_Id | MTP3B signalling route set | STRING |
NNI SAAL signaling Termination Point
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the NNI_SAAL_TP | STRING | |
| Name | A user-friendly name preferably unique for the NNI_SAAL_TP | STRING | |
| Network | Network associated with the NNI_SAAL_TP | STRING | Network |
| Region | Region associated with the NNI_SAAL_TP | STRING | Region |
| RNC | RNC in a UMTS network | STRING | RNC |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the NNI_SAAL_TP | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the NNI_SAAL_TP | STRING |
155 Mb/s transmission
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all OSS155 | STRING | |
| Name | A user-friendly name for a OSS155 | STRING | |
| MGW | The MGW to which this OS155 is connected. | STRING | MGW |
| Region | The Region containing the OSS155 | STRING | Region |
| Network | The Network identifier | STRING | Network |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
Open Shortest Path First (OSPF) routing area
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the OSPF Area | STRING | |
| Name | A user-friendly name preferably unique for the OSPF Area | STRING | |
| OSPF | The OSPF associated with the object | STRING | OSPF |
| RNC | RNC in a UMTS network | STRING | RNC |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| Network | Network associated with the OSPF Area | STRING | Network |
| Region | Region associated with the OSPF Area | STRING | Region |
| Node | The unique identifier for the node this object is connected to OSPF Area | STRING | MGW |
| Node_Type | The type of network element of the node this object is connected to OSPF Area | STRING | |
| Node_Name | A user friendly name for this node the object is connected to OSPF Area | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the OSPF Area | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the OSPF Area | STRING |
Open Shortest Path First (OSPF) routing protocol interface
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the OSPF_Interface | STRING | |
| Name | A user-friendly name preferably unique for the OSPF_Interface | STRING | |
| OSPF | The OSPF associated with the object | STRING | OSPF |
| RNC | RNC in a UMTS network | STRING | RNC |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| Network | Network associated with the OSPF_Interface | STRING | Network |
| Region | Region associated with the OSPF_Interface | STRING | Region |
| Node | The unique identifier for the node this object is connected to OSPF_Interface | STRING | MGW |
| Node_Type | The type of network element of the node this object is connected to OSPF_Interface | STRING | |
| Node_Name | A user friendly name for this node the object is connected to OSPF_Interface | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the OSPF_Interface | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the OSPF_Interface | STRING |
Open Shortest Path First (OSPF) routing protocol
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the OSPF | STRING | |
| Name | A user-friendly name preferably unique for the OSPF | STRING | |
| RNC | RNC in a UMTS network | STRING | RNC |
| NodeB | NodeB in a UTRAN network | STRING | NodeB |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Network | Network associated with the OSPF | STRING | Network |
| Region | Region associated with the OSPF | STRING | Region |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the OSPF | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the OSPF | STRING |
The plug-in-unit board inserted in a slot in a subrack
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the Plug_In_Unit | STRING | |
| Name | A user-friendly name preferably unique for the Plug_In_Unit | STRING | |
| RNC | RNC in a UMTS network | STRING | RNC |
| Network | Network associated with the Plug_In_Unit | STRING | Network |
| Region | Region associated with the Plug_In_Unit | STRING | Region |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the Plug_In_Unit | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the Plug_In_Unit | STRING |
The remote site connected to the MGW node in the same IP subnetwork.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the RemoteSite | STRING | |
| Name | A user-friendly name preferably unique for the RemoteSite | STRING | |
| Network | Network associated with the RemoteSite | STRING | Network |
| Region | Region associated with the RemoteSite | STRING | Region |
| Node | The unique identifier for the node this object is connected to | STRING | MGW |
| Node_Type | The type of network element of the node this object is connected to | STRING | |
| Node_Name | A user friendly name for this node the object is connected to | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS) | STRING | |
| Vendor | Manufacturer of the equipment supporting the RemoteSite | STRING | |
| Version | Hardware/Software version of the of the equipment supporting the RemoteSite | STRING |
Represents a signalling entity that is part of a Node.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique identifier for the SS7 Point. | STRING | |
| Name | A user friendly name preferably unique for the SS7 Point. | STRING | |
| Node | A unique identifier for the Node. | STRING | MGW |
| Region | Region associated with the SS7 Point. SS7_Point - the default value is derived via the Node. | STRING | Region |
| Network | Network associated with the SS7 Point. | STRING | Network |
| Node_Name | A user friendly name preferably unique for the Node. | STRING | |
| Node_Type | Type of Node. | STRING | |
| Technology | Technology of the network/element (e.g. GSM, GPRS, UMTS). | STRING | |
| Adjacent_Node_Id | A unique identifier for the Adjacent Node. | STRING |
A protocol suite designed to transport real time SS7 and ISDN signalling messages over IP networks (instead of TCP).
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all Sigtran performance data. | STRING | |
| Name | A user-friendly name for a Signalling_Transmission. | STRING | |
| MGW | The MGW to which this Signalling_Transmission is connected. | STRING | MGW |
| Region | The Region containing the Sigtran | STRING | Region |
| Network | The Network identifier | STRING | Network |
| Sigtran_Type | network element type | STRING | |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
Basic building block of SONET/SDH; 51.8 Mb/s Synchronous Transport Signal Level N (where N is a multiple of 51.8 Mb/s)
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all STS1 performance data. | STRING | |
| Name | A user-friendly name for a STS1. | STRING | |
| MGW | The MGW to which this STS1 is connected. | STRING | MGW |
| Region | The Region containing the MSC | STRING | Region |
| Network | The Network identifier | STRING | Network |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
Basic building block of SONET/SDH; 155 Mb/s Synchronous Transport Signal Level N (where N is a multiple of 51.8 Mb/s)
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all STS3 performance data. | STRING | |
| Name | A user-friendly name for a STS3. | STRING | |
| MGW | The MGW to which this STS3 is connected. | STRING | MGW |
| Region | The Region containing the MSC | STRING | Region |
| Network | The Network identifier | STRING | Network |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
Plesiochronous Digital Hierarchy interface (1.544 Mb/s)
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all T1 performance data. | STRING | |
| Name | A user-friendly name for a T1. | STRING | |
| MGW | The MGW to which this T1 is connected. | STRING | MGW |
| Region | The Region containing the T1 | STRING | Region |
| Network | The Network identifier | STRING | Network |
| T1_Type | Network element type | STRING | |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
MGW resources responsible for handling Time Division Multiplexing media streams
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all TdmTermGrp performance data | STRING | |
| Name | A user-friendly name for a TdmTermGrp | STRING | |
| MGW | The MGW to which this TdmTermGrp is connected | STRING | MGW |
| Region | The Region containing the MSC | STRING | Region |
| Network | An optional version identifier for the TdmTermGrp | STRING | Network |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
Virtual Container 12 (2.048 Mb/s transmission rate)
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all VC12 performance data. | STRING | |
| Name | A user-friendly name for a VC12. | STRING | |
| MGW | The MGW to which this VC12 is connected | STRING | MGW |
| Region | The Region containing the VC12 | STRING | Region |
| Network | The network identifier | STRING | Network |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
Virtual Container 4 (155 Mb/s transmission rate)
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all VC4 performance data. | STRING | |
| Name | A user-friendly name for a VC4 | STRING | |
| MGW | The MGW to which this VC4 is connected. | STRING | MGW |
| Region | The Region containing the MSC | STRING | Region |
| Network | The Network identifier | STRING | Network |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
ATM Virtual Circuit Termination Point
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | Virtual Channel Link Termination Point identifier | STRING | |
| Name | A user-friendly name for a VclTP | STRING | |
| ATM_Port | ATM Port identifier associated with this VclTp | STRING | ATM_Port |
| VpcTp | Virtual Path Connection Termination Point identifier associated with this VclTp | STRING | VpcTp |
| VplTp_Description | An optional descriptor | STRING | |
| EgressPcr | Egress Peak Cell Rate | INTEGER | |
| IngressPcr | Ingress Peak Cell Rate | INTEGER |
Virtual Media Gateway is a functional entity responsible for H.248 message and connection handler.
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all VMGW performance data | STRING | |
| Name | A user-friendly name for a VMGW | STRING | |
| MGW | The MGW to which this VMGW is connected | STRING | MGW |
| Region | The Region containing the MSC (this is not derived from performance data) | STRING | Region |
| Network | An optional version identifier for the VMGW | STRING | Network |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
ATM Virtual Path Channel Termination Point
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all VpcTP performance data | STRING | |
| Name | A user friendly name for the VpcTp | STRING | |
| VplTp | The VplTp associated with the object | STRING | VplTp |
| ATM_Port | A unique string supplied by the Gateway in all ATM_Port performance data | STRING | ATM_Port |
| EgressAtmPcr | Egress Peak Cell Rate | INTEGER | |
| IngressAtmPcr | Ingress Peak Cell Rate | INTEGER | |
| EgressAtmQos | egress ATM Quality of Service parameter | INTEGER | |
| IngressAtmQos | ingress ATM Quality of Service parameter | INTEGER | |
| EgressAtmMcr | egress Atm Minimum Cell Rate | INTEGER | |
| IngressAtmMcr | ingress Atm Minimum Cell Rate | INTEGER | |
| VpcTp_Description | Optional descriptor | STRING |
ATM Virtual Path Link Termination Point
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | Virtual Path Link Termination Point identifier | STRING | |
| Name | A user-friendly name for a VplTP | STRING | |
| ATM_Port | A unique string supplied by the Gateway in all ATM_Port performance data | STRING | ATM_Port |
| EgressPcr | Egress Peak Cell Rate | INTEGER | |
| IngressPcr | Ingress Peak Cell Rate | INTEGER | |
| EgressAtmQos | ingress Atm Quality of Service parameter | INTEGER | |
| IngressAtmQos | ingress Atm Quality of Service parameter | INTEGER | |
| EgressAtmMcr | egress Atm Minimum Cell Rate | INTEGER | |
| IngressAtmMcr | ingress Atm Minimum Cell Rate | INTEGER | |
| VplTp_Description | An optional descriptor | STRING |
SDH/SONET Virtual Tributary
| Attribute Name | Description | Type | Related Object |
|---|---|---|---|
| ID | A unique string supplied by the Gateway in all VT15 performance data | STRING | |
| Name | A user-friendly name for a VT15 | STRING | |
| MGW | The MGW to which this VT15 is connected | STRING | MGW |
| Region | The Region containing the MGW | STRING | Region |
| Network | The Network identifier | STRING | Network |
| Version | The equipment version | STRING | |
| Vendor | The equipment vendor's name | STRING |
This section describes the reference objects that are used only as lookups for compound-keyed raw data.
Not applicable to this tech pack.
This section lists the busy hours that are defined in this technology pack, grouped by the network object to which they relate, as follows:
| Busy Hour Name | Acronym | Defining KPI |
|---|---|---|
| Ericsson_ATM_Port_Util_Total_Cells_TXRX_Busy_Hour | eraputctbh | ATM_Port.Ericsson.UMTS.ATM_port_utilisation.Total_cells |
| Busy Hour Name | Acronym | Defining KPI |
|---|---|---|
| Ericsson_MGW_Media_Strm_Ch_Busy_Hour | ermgwmsbh | MGW.Ericsson.UMTS.Service_and_software_licensing.pmNrOfMediaStreamChannelsBusy |
| Busy Hour Name | Acronym | Defining KPI |
|---|---|---|
| Ericsson_MGW_PlugInUnit_Load_Busy_Hour | ermpiuldbh | Plug_In_Unit.Ericsson.UMTS.CPU_Load.pmProcessorLoad |
| Busy Hour Name | Acronym | Defining KPI |
|---|---|---|
| Ericsson_VPltp_Total_Cells_TXRX_Busy_Hour | ervpltcbh | VplTp.Ericsson.UMTS.Traffic.Total_cells |
This section lists all performance indicators (both one-to-one counter mappings, and complex KPIs) which are included in this technology pack, ordered by name:
| KPI Name | KPI Group | Network Object |
|---|---|---|
| %_AAL2_Bearer_Est_Succ | Utilisation | VMGW |
| %_AAL2_Pipe_Utilization | Connections | AAL2_Access_Point |
| %_AAL2_Term_Seize_Succ | Utilisation | VMGW |
| %_ATM_Conn_No_Disturbance | Jitter_Measurement | MGW_Resource_Pool |
| %_ATM_Port_Rcvd_Usage | ATM_port_utilisation | ATM_Port |
| %_ATM_Port_Sent_Usage | ATM_port_utilisation | ATM_Port |
| %_data_coverage | Errors | AAL1_Tp_Vcc_Tp |
| %_data_coverage | Connections | AAL2_Access_Point |
| %_data_coverage | Signalling_Messages | AAL2_Access_Point |
| %_data_coverage | AAL2_Sig_Point | AAL2_Signalling_Point |
| %_data_coverage | AAL2_CPS | AAL2PathVccTp |
| %_data_coverage | Errors | AAL2PathVccTp |
| %_data_coverage | Errors | AAL5_Tp_Vcc_Tp |
| %_data_coverage | ATM_port_utilisation | ATM_Port |
| %_data_coverage | Virtual_path_grouped_from_VpcTp | ATM_Port |
| %_data_coverage | Traffic_Descriptor | AtmTrafficDescriptor |
| %_data_coverage | E1_Terminating_Point | E1 |
| %_data_coverage | Active_Speech_Level_Rout | Echo_Cancellation |
| %_data_coverage | Active_Speech_Level_Sout | Echo_Cancellation |
| %_data_coverage | Echo_Return_Loss | Echo_Cancellation |
| %_data_coverage | Pure_Delay | Echo_Cancellation |
| %_data_coverage | Interface_Traffic | Ethernet_Link |
| %_data_coverage | Interface_Traffic | Fast_Ethernet |
| %_data_coverage | Interface_Traffic | GigabitEthernet |
| %_data_coverage | IMA_Group | IMA |
| %_data_coverage | IMA_Link | IMA |
| %_data_coverage | Interactive_Message | Interactive_Messaging |
| %_data_coverage | Link_Traffic | Ip_Atm_Link |
| %_data_coverage | GigabitEthernet_Interface | IP_Interface |
| %_data_coverage | IP_Payload | IP_Interface |
| %_data_coverage | Interface_Traffic | Ip_Protocol_Layer |
| %_data_coverage | Ethernet_Transceiver_Function | Medium_Access_Unit |
| %_data_coverage | Device_Pool | MGW_Resource_Pool |
| %_data_coverage | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| %_data_coverage | GSM_CSD_Fax_Pool | MGW_Resource_Pool |
| %_data_coverage | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| %_data_coverage | Jitter_Measurement | MGW_Resource_Pool |
| %_data_coverage | Tandem_Free_Op | MGW_Resource_Pool |
| %_data_coverage | Utilisation | MGW_Resource_Pool |
| %_data_coverage | Utilisation2 | MGW_Resource_Pool |
| %_data_coverage | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| %_data_coverage | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| %_data_coverage | Accessibility_Retainability | MGW |
| %_data_coverage | Service_and_software_licensing | MGW |
| %_data_coverage | Device_Group_Statistics | MS_Device_Group |
| %_data_coverage | Pool_Status | MS_Device_Pool |
| %_data_coverage | DSP | MS_Processing |
| %_data_coverage | MTP | MTP3B_AP |
| %_data_coverage | MTP | MTP3B_SR |
| %_data_coverage | SAAL | Nni_SAAL_TP |
| %_data_coverage | OS155_Terminating_Point | OS155 |
| %_data_coverage | Area_Route_Table | OSPF_Area |
| %_data_coverage | Interface | OSPF_Interface |
| %_data_coverage | OSPF_Routing_Protocol | OSPF |
| %_data_coverage | CPU_Load | Plug_In_Unit |
| %_data_coverage | Connection_Quality | RemoteSite |
| %_data_coverage | MTP2_Terminating_Point | Signalling_Point |
| %_data_coverage | MTP3b_Signalling_Point | Signalling_Point |
| %_data_coverage | MTP3b_Signalling_Point2 | Signalling_Point |
| %_data_coverage | SCCP_Accounting | Signalling_Point |
| %_data_coverage | SCCP_policing | Signalling_Point |
| %_data_coverage | SCCP_Relay_Signalling_Point | Signalling_Point |
| %_data_coverage | SCCP_Routing_CRC | Signalling_Point |
| %_data_coverage | Utilisation | Signalling_Point |
| %_data_coverage | Stream_Control_Transmission_Protocol | Sigtran |
| %_data_coverage | Stream_Control_Transmission_Protocol_IP | Sigtran |
| %_data_coverage | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| %_data_coverage | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| %_data_coverage | STS1_Terminating_Point | STS1 |
| %_data_coverage | STS3_Terminating_Point | STS3 |
| %_data_coverage | T1_Terminating_Point | T1 |
| %_data_coverage | Utilisation | TdmTermGrp |
| %_data_coverage | VC12_Terminating_Point | VC12 |
| %_data_coverage | VC4_Terminating_Point | VC4 |
| %_data_coverage | Virtual_channel | VclTp |
| %_data_coverage | BCTP | VMGW |
| %_data_coverage | IP_Bearer_Control_Protocol | VMGW |
| %_data_coverage | Iu_Interface | VMGW |
| %_data_coverage | Nb_Interface | VMGW |
| %_data_coverage | Utilisation | VMGW |
| %_data_coverage | Virtual_path | VpcTp |
| %_data_coverage | Traffic | VplTp |
| %_data_coverage | Traffic_agregated_from_VPCTP | VplTp |
| %_data_coverage | VT15_Terminating_Point | VT15 |
| %_Device_Utilization | Pool_Status | MS_Device_Pool |
| %_ECN_Received_Packet | Connection_Quality | RemoteSite |
| %_Emergency_Call_Success | Service_and_software_licensing | MGW |
| %_GCP_Message_Sent_Rcvd | Utilisation | VMGW |
| %_IBPCP_Bearer_Est_Succ | Utilisation | VMGW |
| %_Incoming_AAL2_Conn_Rsrv | Connections | AAL2_Access_Point |
| %_IP_Conn_No_Disturbance | Jitter_Measurement | MGW_Resource_Pool |
| %_IP_Term_Seize_Succ | Utilisation | VMGW |
| %_IP_User_Plane_Quality | Connection_Quality | RemoteSite |
| %_Media_Stream_Channel_Seizure | Service_and_software_licensing | MGW |
| %_Media_Stream_Channel_Utilization | Service_and_software_licensing | MGW |
| %_MGW_Accessibility | Accessibility_Retainability | MGW |
| %_MGW_Retainability | Accessibility_Retainability | MGW |
| %_Orig_Nb_Init_Conn_Succ | Nb_Interface | VMGW |
| %_Outgoing_AAL2_Conn_Rsrv | Connections | AAL2_Access_Point |
| %_pmBusyInstances | Device_Pool | MGW_Resource_Pool |
| %_pmCallAttempts | Interactive_Message | Interactive_Messaging |
| %_pmFtmSucc | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| %_pmFtmSuccGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| %_pmGcpNrOfReceivedMessages | Utilisation | VMGW |
| %_pmGcpSystemUpTime | Utilisation | VMGW |
| %_pmModemOSucc | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| %_pmModemOSuccGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| %_pmModemTSucc | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| %_pmModemTSuccGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| %_pmNoOfForcedRerouteSuccessPerf | MTP3b_Signalling_Point | Signalling_Point |
| %_pmNoOfUnsuccessForcedRerouting | MTP3b_Signalling_Point | Signalling_Point |
| %_pmNrOfAal2TermsReq | Utilisation | VMGW |
| %_pmNrOfContextsReq | Utilisation | VMGW |
| %_pmNrOfIpTermsReq | Utilisation | VMGW |
| %_pmNrOfTdmTermsReq | Utilisation | TdmTermGrp |
| %_pmSuccInConnsRemote | Connections | AAL2_Access_Point |
| %_pmSuccOutConnsRemote | Connections | AAL2_Access_Point |
| %_pmTotalSeizures | Device_Pool | MGW_Resource_Pool |
| %_pmUdiSucc | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| %_pmUdiSuccGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| %_Rcvd_Datagram_Discard | Interface_Traffic | Fast_Ethernet |
| %_Rcvd_Datagram_Discard | GigabitEthernet_Interface | IP_Interface |
| %_Rcvd_Datagram_Discard | IP_Payload | IP_Interface |
| %_Rcvd_Datagram_Discard | Stream_Control_Transmission_Protocol_IP | Sigtran |
| %_Rcvd_Packets_Discard | Interface_Traffic | Fast_Ethernet |
| %_Received_IP_Packet_Err_Host | IP_Payload | IP_Interface |
| %_Received_IP_Packet_Err_Intf | GigabitEthernet_Interface | IP_Interface |
| %_RTP_Discard | Connection_Quality | RemoteSite |
| %_RTP_Loss | Connection_Quality | RemoteSite |
| %_Rvcd_IP_Packet_Err | Stream_Control_Transmission_Protocol_IP | Sigtran |
| %_Sent_Datagram_Discard | Interface_Traffic | Fast_Ethernet |
| %_Sent_Datagram_Discard | GigabitEthernet_Interface | IP_Interface |
| %_Sent_Datagram_Discard | IP_Payload | IP_Interface |
| %_Sent_Datagram_Discard | Stream_Control_Transmission_Protocol_IP | Sigtran |
| %_Sent_Packets_Discard | Interface_Traffic | Fast_Ethernet |
| %_Service_Reserve_Succ | Device_Pool | MGW_Resource_Pool |
| %_SS7_Signal_Quality_ATM | SAAL | Nni_SAAL_TP |
| %_SS7_Signal_Quality_TDM | MTP2_Terminating_Point | Signalling_Point |
| %_TDM_Term_Reserve_Succ | Utilisation | TdmTermGrp |
| %_TDM_Utilization | Utilisation | TdmTermGrp |
| %_TFO_Fallback_PCM_AMR_Success | Tandem_Free_Op | MGW_Resource_Pool |
| %_TFO_Fallback_PCM_EFR_Success | Tandem_Free_Op | MGW_Resource_Pool |
| AAL2_Pipe_Utilization_denom | Connections | AAL2_Access_Point |
| Avg_MSU_Rcvd_Rate | MTP2_Terminating_Point | Signalling_Point |
| Avg_MSU_Rcvd_Rate | Utilisation | Signalling_Point |
| Avg_MSU_Sent_Rate | MTP2_Terminating_Point | Signalling_Point |
| Avg_MSU_Sent_Rate | Utilisation | Signalling_Point |
| Avg_Payload_Msg_Rvcd | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| Avg_Payload_Msg_Sent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| Avg_Rvcd_Bandwidth | Interface_Traffic | Fast_Ethernet |
| Avg_Tx_Bandwidth | Interface_Traffic | Fast_Ethernet |
| capacityBusy | Pool_Status | MS_Device_Pool |
| capacityDependencyFailed | Pool_Status | MS_Device_Pool |
| capacityDependencyLocked | Pool_Status | MS_Device_Pool |
| capacityFailed | Pool_Status | MS_Device_Pool |
| capacityIdle | Pool_Status | MS_Device_Pool |
| capacityLevelReservedForPriorityCalls | Pool_Status | MS_Device_Pool |
| Cer_Rx | Traffic | VplTp |
| Cer_Tx | Traffic | VplTp |
| Clr_Rx | Traffic | VplTp |
| Clr_Tx | Traffic | VplTp |
| Cmr_Rx | Traffic | VplTp |
| Cmr_Tx | Traffic | VplTp |
| Current_MGW_Traffic_Load | Service_and_software_licensing | MGW |
| deviceType | Pool_Status | MS_Device_Pool |
| egressAtmMcr | Traffic_Descriptor | AtmTrafficDescriptor |
| egressAtmPcr | Traffic_Descriptor | AtmTrafficDescriptor |
| egressAtmQos | Traffic_Descriptor | AtmTrafficDescriptor |
| ingressAtmMcr | Traffic_Descriptor | AtmTrafficDescriptor |
| ingressAtmPcr | Traffic_Descriptor | AtmTrafficDescriptor |
| ingressAtmQos | Traffic_Descriptor | AtmTrafficDescriptor |
| maxNrOfDevices | Pool_Status | MS_Device_Pool |
| maxNrOfLicMediaStreamChannels | Service_and_software_licensing | MGW |
| MTP2_Link_Rcvd_Rate | MTP2_Terminating_Point | Signalling_Point |
| MTP2_Link_Sent_Rate | MTP2_Terminating_Point | Signalling_Point |
| nrOfConfiguredAal2Paths | Connections | AAL2_Access_Point |
| nrOfUnavailableAal2Paths | Connections | AAL2_Access_Point |
| pmAsyncNonTransModemGsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmAsyncNonTransModemWcdma | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| pmAsyncTransModemGsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmAtmCnConnLatePktsRatio0 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnLatePktsRatio1 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnLatePktsRatio2 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnLatePktsRatio3 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnLatePktsRatio4 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnLatePktsRatio5 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnLatePktsRatio6 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnMeasuredJitter0 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnMeasuredJitter1 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnMeasuredJitter2 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnMeasuredJitter3 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnMeasuredJitter4 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmCnConnMeasuredJitter5 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnLatePktsRatio0 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnLatePktsRatio1 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnLatePktsRatio2 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnLatePktsRatio3 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnLatePktsRatio4 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnLatePktsRatio5 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnLatePktsRatio6 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnMeasuredJitter0 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnMeasuredJitter1 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnMeasuredJitter2 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnMeasuredJitter3 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnMeasuredJitter4 | Jitter_Measurement | MGW_Resource_Pool |
| pmAtmRanConnMeasuredJitter5 | Jitter_Measurement | MGW_Resource_Pool |
| pmBitTransFail | Utilisation2 | MGW_Resource_Pool |
| pmBitTransSucc | Utilisation2 | MGW_Resource_Pool |
| pmBusyDevices | Device_Pool | MGW_Resource_Pool |
| pmBusyInstances | Device_Pool | MGW_Resource_Pool |
| pmBwErrBlocks | Errors | AAL1_Tp_Vcc_Tp |
| pmBwErrBlocks | Errors | AAL2PathVccTp |
| pmBwErrBlocks | Errors | AAL5_Tp_Vcc_Tp |
| pmBwErrBlocks | Virtual_path_grouped_from_VpcTp | ATM_Port |
| pmBwErrBlocks | Virtual_path | VpcTp |
| pmBwErrBlocks | Traffic_agregated_from_VPCTP | VplTp |
| pmBwLostCells | Errors | AAL1_Tp_Vcc_Tp |
| pmBwLostCells | Errors | AAL2PathVccTp |
| pmBwLostCells | Errors | AAL5_Tp_Vcc_Tp |
| pmBwLostCells | Virtual_path_grouped_from_VpcTp | ATM_Port |
| pmBwLostCells | Virtual_path | VpcTp |
| pmBwLostCells | Traffic_agregated_from_VPCTP | VplTp |
| pmBwMissinCells | Errors | AAL2PathVccTp |
| pmBwMissinsCells | Errors | AAL1_Tp_Vcc_Tp |
| pmBwMissinsCells | Errors | AAL2PathVccTp |
| pmBwMissinsCells | Errors | AAL5_Tp_Vcc_Tp |
| pmBwMissinsCells | Virtual_path_grouped_from_VpcTp | ATM_Port |
| pmBwMissinsCells | Virtual_path | VpcTp |
| pmBwMissinsCells | Traffic_agregated_from_VPCTP | VplTp |
| pmCallAttempts | Interactive_Message | Interactive_Messaging |
| pmCallsWithRtpPacketLoss0 | Connection_Quality | RemoteSite |
| pmCallsWithRtpPacketLoss1 | Connection_Quality | RemoteSite |
| pmCallsWithRtpPacketLoss2 | Connection_Quality | RemoteSite |
| pmCallsWithRtpPacketLoss3 | Connection_Quality | RemoteSite |
| pmCallsWithRtpPacketLoss4 | Connection_Quality | RemoteSite |
| pmCallsWithRtpPacketLoss5 | Connection_Quality | RemoteSite |
| pmCallsWithRtpPacketLoss6 | Connection_Quality | RemoteSite |
| pmConnLatePktsRatio0 | Connection_Quality | RemoteSite |
| pmConnLatePktsRatio1 | Connection_Quality | RemoteSite |
| pmConnLatePktsRatio2 | Connection_Quality | RemoteSite |
| pmConnLatePktsRatio3 | Connection_Quality | RemoteSite |
| pmConnLatePktsRatio4 | Connection_Quality | RemoteSite |
| pmConnLatePktsRatio5 | Connection_Quality | RemoteSite |
| pmConnLatePktsRatio6 | Connection_Quality | RemoteSite |
| pmConnMeasuredJitter0 | Connection_Quality | RemoteSite |
| pmConnMeasuredJitter1 | Connection_Quality | RemoteSite |
| pmConnMeasuredJitter2 | Connection_Quality | RemoteSite |
| pmConnMeasuredJitter3 | Connection_Quality | RemoteSite |
| pmConnMeasuredJitter4 | Connection_Quality | RemoteSite |
| pmConnMeasuredJitter5 | Connection_Quality | RemoteSite |
| pmDiscardedEgressCpsPackets | AAL2_CPS | AAL2PathVccTp |
| pmDot1qTpVlanPortInDiscardsLink1 | Interface_Traffic | GigabitEthernet |
| pmDot1qTpVlanPortInDiscardsLink2 | Interface_Traffic | GigabitEthernet |
| pmDot1qTpVlanPortInFrames | GigabitEthernet_Interface | IP_Interface |
| pmDot1qTpVlanPortOutFrames | GigabitEthernet_Interface | IP_Interface |
| pmEgressCpsPackets | AAL2_CPS | AAL2PathVccTp |
| pmEs | E1_Terminating_Point | E1 |
| pmEs | T1_Terminating_Point | T1 |
| pmEs | VT15_Terminating_Point | VT15 |
| pmEsp | STS1_Terminating_Point | STS1 |
| pmEsp | STS3_Terminating_Point | STS3 |
| pmExisOrigConns | Connections | AAL2_Access_Point |
| pmExisTermConns | Connections | AAL2_Access_Point |
| pmExisTransConns | Connections | AAL2_Access_Point |
| pmFailedCallAttempts | Interactive_Message | Interactive_Messaging |
| pmForcedRelease | Device_Pool | MGW_Resource_Pool |
| pmFtmCalls | Utilisation | MGW_Resource_Pool |
| pmFtmCallsFail | Utilisation | MGW_Resource_Pool |
| pmFtmCallsSuccess | Utilisation | MGW_Resource_Pool |
| pmFtmFail | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmFtmFailGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmFtmSucc | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmFtmSuccGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmFwErrBlocks | Errors | AAL1_Tp_Vcc_Tp |
| pmFwErrBlocks | Errors | AAL2PathVccTp |
| pmFwErrBlocks | Errors | AAL5_Tp_Vcc_Tp |
| pmFwErrBlocks | Virtual_path_grouped_from_VpcTp | ATM_Port |
| pmFwErrBlocks | Virtual_path | VpcTp |
| pmFwErrBlocks | Traffic_agregated_from_VPCTP | VplTp |
| pmFwLostCells | Errors | AAL1_Tp_Vcc_Tp |
| pmFwLostCells | Errors | AAL2PathVccTp |
| pmFwLostCells | Errors | AAL5_Tp_Vcc_Tp |
| pmFwLostCells | Virtual_path_grouped_from_VpcTp | ATM_Port |
| pmFwLostCells | Virtual_path | VpcTp |
| pmFwLostCells | Traffic_agregated_from_VPCTP | VplTp |
| pmFwMissinCells | Errors | AAL2PathVccTp |
| pmFwMissinsCells | Errors | AAL1_Tp_Vcc_Tp |
| pmFwMissinsCells | Errors | AAL2PathVccTp |
| pmFwMissinsCells | Errors | AAL5_Tp_Vcc_Tp |
| pmFwMissinsCells | Virtual_path_grouped_from_VpcTp | ATM_Port |
| pmFwMissinsCells | Virtual_path | VpcTp |
| pmFwMissinsCells | Traffic_agregated_from_VPCTP | VplTp |
| pmGcpNrOfReceivedMessages | Utilisation | VMGW |
| pmGcpNrOfSentMessages | Utilisation | VMGW |
| pmGcpNrOfTimerRecovery | Utilisation | VMGW |
| pmGcpSystemUpTime | Utilisation | VMGW |
| pmGrFc | IMA_Group | IMA |
| pmGrFcFe | IMA_Group | IMA |
| pmGrUasIma | IMA_Group | IMA |
| pmHandovers | Utilisation | MGW_Resource_Pool |
| pmI10ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI10ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI10ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI10ValPd | Pure_Delay | Echo_Cancellation |
| pmI11ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI11ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI11ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI11ValPd | Pure_Delay | Echo_Cancellation |
| pmI12ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI12ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI12ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI12ValPd | Pure_Delay | Echo_Cancellation |
| pmI13ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI13ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI13ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI13ValPd | Pure_Delay | Echo_Cancellation |
| pmI14ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI14ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI14ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI14ValPd | Pure_Delay | Echo_Cancellation |
| pmI15ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI15ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI15ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI15ValPd | Pure_Delay | Echo_Cancellation |
| pmI16ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI16ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI16ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI16ValPd | Pure_Delay | Echo_Cancellation |
| pmI1ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI1ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI1ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI1ValPd | Pure_Delay | Echo_Cancellation |
| pmI2ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI2ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI2ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI2ValPd | Pure_Delay | Echo_Cancellation |
| pmI3ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI3ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI3ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI3ValPd | Pure_Delay | Echo_Cancellation |
| pmI4ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI4ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI4ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI4ValPd | Pure_Delay | Echo_Cancellation |
| pmI5ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI5ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI5ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI5ValPd | Pure_Delay | Echo_Cancellation |
| pmI6ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI6ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI6ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI6ValPd | Pure_Delay | Echo_Cancellation |
| pmI7ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI7ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI7ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI7ValPd | Pure_Delay | Echo_Cancellation |
| pmI8ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI8ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI8ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI8ValPd | Pure_Delay | Echo_Cancellation |
| pmI9ValAslr | Active_Speech_Level_Rout | Echo_Cancellation |
| pmI9ValAsls | Active_Speech_Level_Sout | Echo_Cancellation |
| pmI9ValErl | Echo_Return_Loss | Echo_Cancellation |
| pmI9ValPd | Pure_Delay | Echo_Cancellation |
| pmIcmpInDestUnreachs | IP_Payload | IP_Interface |
| pmIcmpInDestUnreachs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpInEchoReps | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpInEchos | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpInErrors | IP_Payload | IP_Interface |
| pmIcmpInErrors | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpInMsgs | IP_Payload | IP_Interface |
| pmIcmpInMsgs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpInParamProbs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpInRedirects | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpInSrcQuenchs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpInTimeExcds | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpOutDestUnreachs | IP_Payload | IP_Interface |
| pmIcmpOutDestUnreachs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpOutEchoReps | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpOutEchos | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpOutErrors | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpOutMsgs | IP_Payload | IP_Interface |
| pmIcmpOutMsgs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIcmpOutParamProbs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIfInBroadcastPkts | Interface_Traffic | Fast_Ethernet |
| pmIfInBroadcastPktsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfInBroadcastPktsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfInDiscards | Interface_Traffic | Fast_Ethernet |
| pmIfInDiscardsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfInDiscardsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfInErrors | Interface_Traffic | Fast_Ethernet |
| pmIfInErrorsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfInErrorsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfInMulticastPkts | Interface_Traffic | Fast_Ethernet |
| pmIfInMulticastPktsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfInMulticastPktsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfInOctetsHi | Interface_Traffic | Fast_Ethernet |
| pmIfInOctetsLink1Hi | Interface_Traffic | GigabitEthernet |
| pmIfInOctetsLink1Lo | Interface_Traffic | GigabitEthernet |
| pmIfInOctetsLink2Hi | Interface_Traffic | GigabitEthernet |
| pmIfInOctetsLink2Lo | Interface_Traffic | GigabitEthernet |
| pmIfInOctetsLo | Interface_Traffic | Fast_Ethernet |
| pmIfInUcastPkts | Interface_Traffic | Fast_Ethernet |
| pmIfInUcastPktsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfInUcastPktsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfInUnknownProtos | Interface_Traffic | Fast_Ethernet |
| pmIfInUnknownProtosLink1 | Interface_Traffic | GigabitEthernet |
| pmIfInUnknownProtosLink2 | Interface_Traffic | GigabitEthernet |
| pmIfOutBroadcastPkts | Interface_Traffic | Fast_Ethernet |
| pmIfOutBroadcastPktsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfOutBroadcastPktsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfOutDiscards | Interface_Traffic | Fast_Ethernet |
| pmIfOutDiscardsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfOutDiscardsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfOutErrors | Interface_Traffic | Fast_Ethernet |
| pmIfOutErrorsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfOutErrorsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfOutMulticastPkts | Interface_Traffic | Fast_Ethernet |
| pmIfOutMulticastPktsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfOutMulticastPktsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfOutOctetsHi | Interface_Traffic | Fast_Ethernet |
| pmIfOutOctetsLink1Hi | Interface_Traffic | GigabitEthernet |
| pmIfOutOctetsLink1Lo | Interface_Traffic | GigabitEthernet |
| pmIfOutOctetsLink2Hi | Interface_Traffic | GigabitEthernet |
| pmIfOutOctetsLink2Lo | Interface_Traffic | GigabitEthernet |
| pmIfOutOctetsLo | Interface_Traffic | Fast_Ethernet |
| pmIfOutUcastPkts | Interface_Traffic | Fast_Ethernet |
| pmIfOutUcastPktsLink1 | Interface_Traffic | GigabitEthernet |
| pmIfOutUcastPktsLink2 | Interface_Traffic | GigabitEthernet |
| pmIfStatsIpAddrErrors | GigabitEthernet_Interface | IP_Interface |
| pmIfStatsIpInDiscards | GigabitEthernet_Interface | IP_Interface |
| pmIfStatsIpInHdrErrors | GigabitEthernet_Interface | IP_Interface |
| pmIfStatsIpInReceives | GigabitEthernet_Interface | IP_Interface |
| pmIfStatsIpOutDiscards | GigabitEthernet_Interface | IP_Interface |
| pmIfStatsIpOutRequests | GigabitEthernet_Interface | IP_Interface |
| pmIfStatsIpUnknownProtos | GigabitEthernet_Interface | IP_Interface |
| pmIngressCpsPackets | AAL2_CPS | AAL2PathVccTp |
| pmIpCnConnLatePktsRatio0 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnLatePktsRatio1 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnLatePktsRatio2 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnLatePktsRatio3 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnLatePktsRatio4 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnLatePktsRatio5 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnLatePktsRatio6 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnMeasuredJitter0 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnMeasuredJitter1 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnMeasuredJitter2 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnMeasuredJitter3 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnMeasuredJitter4 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpCnConnMeasuredJitter5 | Jitter_Measurement | MGW_Resource_Pool |
| pmIpFragCreates | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpFragFails | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpFragOKs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpInAddrErrors | IP_Payload | IP_Interface |
| pmIpInAddrErrors | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpInDelivers | IP_Payload | IP_Interface |
| pmIpInDelivers | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpInDiscards | IP_Payload | IP_Interface |
| pmIpInDiscards | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpInHdrErrors | IP_Payload | IP_Interface |
| pmIpInHdrErrors | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpInReceives | IP_Payload | IP_Interface |
| pmIpInReceives | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpInUnknownProtos | IP_Payload | IP_Interface |
| pmIpInUnknownProtos | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpOutDiscards | IP_Payload | IP_Interface |
| pmIpOutDiscards | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpOutRequests | IP_Payload | IP_Interface |
| pmIpOutRequests | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpReasmFails | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpReasmOKs | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpReasmReqds | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmIpReceivedEcnPkts | Connection_Quality | RemoteSite |
| pmIvIma | IMA_Link | IMA |
| pmLatePktsAtmCn | Jitter_Measurement | MGW_Resource_Pool |
| pmLatePktsAtmRan | Jitter_Measurement | MGW_Resource_Pool |
| pmLatePktsDueToDeJitter | Connection_Quality | RemoteSite |
| pmLatePktsIpCn | Jitter_Measurement | MGW_Resource_Pool |
| pmLinkInServiceTime | SAAL | Nni_SAAL_TP |
| pmLocalSIBTime | MTP2_Terminating_Point | Signalling_Point |
| pmLostBrCells | Errors | AAL1_Tp_Vcc_Tp |
| pmLostBrCells | Errors | AAL2PathVccTp |
| pmLostBrCells | Errors | AAL5_Tp_Vcc_Tp |
| pmLostBrCells | Virtual_path_grouped_from_VpcTp | ATM_Port |
| pmLostBrCells | Virtual_path | VpcTp |
| pmLostBrCells | Traffic_agregated_from_VPCTP | VplTp |
| pmLostFpmCells | Errors | AAL1_Tp_Vcc_Tp |
| pmLostFpmCells | Errors | AAL2PathVccTp |
| pmLostFpmCells | Errors | AAL5_Tp_Vcc_Tp |
| pmLostFpmCells | Virtual_path_grouped_from_VpcTp | ATM_Port |
| pmLostFpmCells | Virtual_path | VpcTp |
| pmLostFpmCells | Traffic_agregated_from_VPCTP | VplTp |
| pmModemOFail | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmModemOFailGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmModemOrig | Utilisation | MGW_Resource_Pool |
| pmModemOrigFail | Utilisation | MGW_Resource_Pool |
| pmModemOrigSuccess | Utilisation | MGW_Resource_Pool |
| pmModemOSucc | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmModemOSuccGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmModemTerm | Utilisation | MGW_Resource_Pool |
| pmModemTermFail | Utilisation | MGW_Resource_Pool |
| pmModemTermSuccess | Utilisation | MGW_Resource_Pool |
| pmModemTFail | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmModemTFailGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmModemTSucc | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmModemTSuccGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmMsBbe | OS155_Terminating_Point | OS155 |
| pmMsEs | OS155_Terminating_Point | OS155 |
| pmMsSes | OS155_Terminating_Point | OS155 |
| pmMsUas | OS155_Terminating_Point | OS155 |
| pmNInvalid | Pure_Delay | Echo_Cancellation |
| pmNoOfAALINServiceInd | Utilisation | Signalling_Point |
| pmNoOfAALOUTInd | Utilisation | Signalling_Point |
| pmNoOfAdjacentSPNotAccessible | MTP | MTP3B_AP |
| pmNoOfAlignmentFailures | SAAL | Nni_SAAL_TP |
| pmNoOfAllSLFailures | SAAL | Nni_SAAL_TP |
| pmNoOfAMROnNbConns | Nb_Interface | VMGW |
| pmNoOfAspacAckReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspacAckSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspacReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspacSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspdnAckReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspdnAckSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspdnReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspdnSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspiaAckReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspiaAckSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspiaReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspiaSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspupAckReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspupAckSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspupReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfAspupSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfCBARec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfCBASent | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfCBDSent | Utilisation | Signalling_Point |
| pmNoOfChangeBackDeclRec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfChangeOverRec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfCOAXCARec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfCOAXCASent | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfCommunicationLost | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfCongestions | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfConInUseExceedHighWaterMark | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfConInUseReceededLowWaterMark | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfConnectFailure | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfControlledRerouteSuccessPerf | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfCOOXCOSent | Utilisation | Signalling_Point |
| pmNoOfCREFRecFromNL | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfCREFSentToNL | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfCrRec | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfCrSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfDataMsgRec | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDataMsgSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDaudMsgSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDaudReceived | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDavaRec | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDavaSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDiscardedMsgFromBroadToNarrow | MTP3b_Signalling_Point2 | Signalling_Point |
| pmNoOfDot3StatsFCSErrors | Ethernet_Transceiver_Function | Medium_Access_Unit |
| pmNoOfDot3StatsLateCollisions | Ethernet_Transceiver_Function | Medium_Access_Unit |
| pmNoOfDT1Rec | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfDT1Sent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfDunaRec | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDunaSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDupuRec | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfDupuSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfECARec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfECASent | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfECOSent | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfEFROnNbConns | Nb_Interface | VMGW |
| pmNoOfEmergencyChangeOverRec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfErrorMsgRec | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfErrorMsgSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfERRRec | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfERRSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfForcedRerouteSuccessPerf | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfHdrErrors | Interface_Traffic | Ip_Protocol_Layer |
| pmNoOfHopCounterViolation | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfIfInBroadcastPkts | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmNoOfIfInDiscards | Interface_Traffic | Ethernet_Link |
| pmNoOfIfInDiscards | Link_Traffic | Ip_Atm_Link |
| pmNoOfIfInDiscards | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmNoOfIfInErrors | Interface_Traffic | Ethernet_Link |
| pmNoOfIfInErrors | Link_Traffic | Ip_Atm_Link |
| pmNoOfIfInErrors | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmNoOfIfInMulticastPkts | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmNoOfIfInNUcastPkts | Interface_Traffic | Ethernet_Link |
| pmNoOfIfInNUcastPkts | Link_Traffic | Ip_Atm_Link |
| pmNoOfIfInUcastPkts | Interface_Traffic | Ethernet_Link |
| pmNoOfIfInUcastPkts | Link_Traffic | Ip_Atm_Link |
| pmNoOfIfInUcastPkts | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmNoOfIfOutBroadcastPkts | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmNoOfIfOutDiscards | Interface_Traffic | Ethernet_Link |
| pmNoOfIfOutDiscards | Link_Traffic | Ip_Atm_Link |
| pmNoOfIfOutMulticastPkts | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmNoOfIfOutNUcastPkts | Interface_Traffic | Ethernet_Link |
| pmNoOfIfOutNUcastPkts | Link_Traffic | Ip_Atm_Link |
| pmNoOfIfOutUcastPkts | Interface_Traffic | Ethernet_Link |
| pmNoOfIfOutUcastPkts | Link_Traffic | Ip_Atm_Link |
| pmNoOfIfOutUcastPkts | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmNoOfIncAssocEstReqInStateDwnStateEstBlocked | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfIpAddrErrors | Interface_Traffic | Ip_Protocol_Layer |
| pmNoOfIpForwDatagrams | Interface_Traffic | Ip_Protocol_Layer |
| pmNoOfIpInDiscards | Interface_Traffic | Ip_Protocol_Layer |
| pmNoOfIpInReceives | Interface_Traffic | Ip_Protocol_Layer |
| pmNoOfIpOutDiscards | Interface_Traffic | Ip_Protocol_Layer |
| pmNoOfIpReasmOKs | Interface_Traffic | Ip_Protocol_Layer |
| pmNoOfIpReasmReqds | Interface_Traffic | Ip_Protocol_Layer |
| pmNoOfLocalCongestions | SAAL | Nni_SAAL_TP |
| pmNoOfLocalLinkCongestCeaseRec | Utilisation | Signalling_Point |
| pmNoOfLocalLinkCongestRec | Utilisation | Signalling_Point |
| pmNoOfLowerPrioMsgDiscarded | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfLUDTRec | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfLUDTSSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfM3uaDataMsgDiscarded | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfMaxTrialsForAssocActivReached | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfMaxTrialsForAssocEstabReached | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfMsg | SCCP_Accounting | Signalling_Point |
| pmNoOfMSURec | Utilisation | Signalling_Point |
| pmNoOfMSUReceived | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfMSUSent | Utilisation | Signalling_Point |
| pmNoOfMSUTransmitted | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfNacks | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfNoResponses | SAAL | Nni_SAAL_TP |
| pmNoOfNotifyMsgRec | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfOctets | SCCP_Accounting | Signalling_Point |
| pmNoOfOspfIfEvents | Interface | OSPF_Interface |
| pmNoOfOspfOriginateNewLsas | OSPF_Routing_Protocol | OSPF |
| pmNoOfOspfRxNewLsas | OSPF_Routing_Protocol | OSPF |
| pmNoOfOspfSpfRuns | Area_Route_Table | OSPF_Area |
| pmNoOfOtherErrors | SAAL | Nni_SAAL_TP |
| pmNoOfPCMOnNbConns | Nb_Interface | VMGW |
| pmNoOfProtocolErrors | SAAL | Nni_SAAL_TP |
| pmNoOfReceivedSDUs | SAAL | Nni_SAAL_TP |
| pmNoOfRejectMsg | SCCP_policing | Signalling_Point |
| pmNoOfRemoteCongestions | SAAL | Nni_SAAL_TP |
| pmNoOfReTransmittedOctets | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfRLSDRecFromNL | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfRLSDSentToNL | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfRoutingFailNetworkCongest | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfRoutingFailNoTransAddOfSuchNature | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfRoutingFailNoTransSpecificAddr | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfRoutingFailReasonUnknown | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfRoutingFailSubsysUnavail | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfRoutingFailUnequippedSubsys | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfRoutingFailure | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfRoutingFailurePointCodeUnAvail | SCCP_Routing_CRC | Signalling_Point |
| pmNoOfSconRec | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfSconSent | Stream_Control_Transmission_Protocol_M3UA | Sigtran |
| pmNoOfSctpAssociationRestart | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| pmNoOfSctpBufOverflow | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| pmNoOfSctpCommunicationErr | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| pmNoOfSctpNetworkStatusChange | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| pmNoOfSctpResumeSending | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| pmNoOfSctpSendFailure | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| pmNoOfSecondsAccumulatedRouteUnavailable | MTP | MTP3B_SR |
| pmNoOfSecsAccRouteSetUnavailable | MTP3b_Signalling_Point2 | Signalling_Point |
| pmNoOfSendBufferOctets | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfSentSDUs | SAAL | Nni_SAAL_TP |
| pmNoOfSequenceDataLosses | SAAL | Nni_SAAL_TP |
| pmNoOfSIOSIFReceived | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfSIOSIFTransmitted | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfSLTAFirstTimeOutRec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfSLTASecondTimeOutRec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfStartedRBCongestion | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfSubsysAllowedSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfSuccessAssocAbort | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfSuccessAssocEstablish | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| pmNoOfSuccessAssocShutDown | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfSuReceivedInError | MTP2_Terminating_Point | Signalling_Point |
| pmNoOfTimerT21WasStarted | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfTransferAllowedRec | MTP3b_Signalling_Point2 | Signalling_Point |
| pmNoOfTransferControlledRec | MTP3b_Signalling_Point2 | Signalling_Point |
| pmNoOfTransferProhibitedRec | MTP3b_Signalling_Point2 | Signalling_Point |
| pmNoOfTRARec | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfTRASent | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfUDTRec | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfUDTSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfUDTSRec | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfUDTSSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfUnsuccessAssocEstablish | Stream_Control_Transmission_Protocol_MTP3 | Sigtran |
| pmNoOfUnsuccessAssocShutDown | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfUnsuccessControlledRerouting | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfUnsuccessForcedRerouting | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfUnsuccReTransmissions | SAAL | Nni_SAAL_TP |
| pmNoOfUPMsgDiscardedDueToRoutingErr | MTP3b_Signalling_Point | Signalling_Point |
| pmNoOfUserPartUnavailRec | MTP | MTP3B_AP |
| pmNoOfXUDTRec | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfXUDTSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfXUDTSRec | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNoOfXUDTSSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| pmNormalRelease | Device_Pool | MGW_Resource_Pool |
| pmNrOfAal2TermsBusy | Utilisation | VMGW |
| pmNrOfAal2TermsRej | Accessibility_Retainability | MGW |
| pmNrOfAal2TermsRej | Utilisation | VMGW |
| pmNrOfAal2TermsReq | Accessibility_Retainability | MGW |
| pmNrOfAal2TermsReq | Utilisation | VMGW |
| pmNrOfAdmCtrlRejectedConnections | Connection_Quality | RemoteSite |
| pmNrOfConnIcmpDestUnreachs | Utilisation | VMGW |
| pmNrOfContextsBusy | Utilisation | VMGW |
| pmNrOfContextsRej | Utilisation | VMGW |
| pmNrOfContextsReq | Utilisation | VMGW |
| pmNrOfEmergencyCalls | Service_and_software_licensing | MGW |
| pmNrOfGcpNotifyCsdFaultAEst | Accessibility_Retainability | MGW |
| pmNrOfGcpNotifyCsdFaultAEst | Utilisation | VMGW |
| pmNrOfGcpNotifyCsdFaultBEst | Utilisation | VMGW |
| pmNrOfGcpNotifySpeechFaultAEst | Accessibility_Retainability | MGW |
| pmNrOfGcpNotifySpeechFaultAEst | Utilisation | VMGW |
| pmNrOfGcpNotifySpeechFaultBEst | Utilisation | VMGW |
| pmNrOfGcpOctetsRec | Utilisation | VMGW |
| pmNrOfGcpOctetsSent | Utilisation | VMGW |
| pmNrOfGcpRetrans | Utilisation | VMGW |
| pmNrOfGcpSentPendingMess | Utilisation | VMGW |
| pmNrOfGcpTransactionWithMaxRetr | Utilisation | VMGW |
| pmNrOfGcpTransWithMaxPendingMess | Utilisation | VMGW |
| pmNrOfInternalAal2ConnEstabFail | Utilisation | VMGW |
| pmNrOfInvokedGcpLoadControl | Utilisation | VMGW |
| pmNrOfIpTermsBusy | Utilisation | VMGW |
| pmNrOfIpTermsRej | Accessibility_Retainability | MGW |
| pmNrOfIpTermsRej | Utilisation | VMGW |
| pmNrOfIpTermsReq | Accessibility_Retainability | MGW |
| pmNrOfIpTermsReq | Utilisation | VMGW |
| pmNrOfIuTermAal2BearEstabFailLoc | Utilisation | VMGW |
| pmNrOfIuTermAal2BearEstabFailRem | Utilisation | VMGW |
| pmNrOfMediaStreamChannelsBusy | Service_and_software_licensing | MGW |
| pmNrOfMediaStreamChannelsRejectedDueToCapacity | Accessibility_Retainability | MGW |
| pmNrOfMediaStreamChannelsRejectedDueToCapacity | Service_and_software_licensing | MGW |
| pmNrOfMediaStreamChannelsReq | Service_and_software_licensing | MGW |
| pmNrOfNbOrigAal2BearEstabFailLoc | Utilisation | VMGW |
| pmNrOfNbOrigAal2BearEstabFailRem | Utilisation | VMGW |
| pmNrOfNbTermAal2BearEstabFailLoc | Utilisation | VMGW |
| pmNrOfNbTermAal2BearEstabFailRem | Utilisation | VMGW |
| pmNrOfOrigIpbcpBearPrepRejected | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfOrigIpbcpBearSupervTmrExp | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfOrigNbInit | Nb_Interface | VMGW |
| pmNrOfOrigNbInitFaults | Nb_Interface | VMGW |
| pmNrOfRecBctpProtocolFailures | BCTP | VMGW |
| pmNrOfRecFaultyIpbcpAcceptMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfRecIpbcpAcceptMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfRecIpbcpConfusedMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfRecIpbcpRejectMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfRecIpbcpRequestMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfRejEmcCalls | Service_and_software_licensing | MGW |
| pmNrOfRejsByStaticAdmCtrl | Service_and_software_licensing | MGW |
| pmNrOfSentBctpProtocolFailures | BCTP | VMGW |
| pmNrOfSentIpbcpAcceptMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfSentIpbcpConfusedMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfSentIpbcpRejectMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfSentIpbcpRequestMsg | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfTdmTermsBusy | Utilisation | TdmTermGrp |
| pmNrOfTdmTermsFaulty | Utilisation | VMGW |
| pmNrOfTdmTermsLocked | Utilisation | VMGW |
| pmNrOfTdmTermsRej | Utilisation | TdmTermGrp |
| pmNrOfTDMTermsRej | Accessibility_Retainability | MGW |
| pmNrOfTdmTermsReq | Utilisation | TdmTermGrp |
| pmNrOfTDMTermsReq | Accessibility_Retainability | MGW |
| pmNrOfTermIpbcpBearPrepRejected | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfTermIpbcpBearSupervTmrExp | IP_Bearer_Control_Protocol | VMGW |
| pmNrOfTermIuInit | Iu_Interface | VMGW |
| pmNrOfTermIuInitSucc | Iu_Interface | VMGW |
| pmNrOfTermNbInit | Nb_Interface | VMGW |
| pmNrOfTermNbInitSucc | Nb_Interface | VMGW |
| pmNumBitTrans | Utilisation2 | MGW_Resource_Pool |
| pmNumFtm | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmNumFtmGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmNumModemO | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmNumModemOGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmNumModemT | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmNumModemTGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmNumUdi | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmNumUdiGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmOifIma | IMA_Link | IMA |
| pmProcessorLoad | CPU_Load | Plug_In_Unit |
| pmReceivedAtmCells | ATM_port_utilisation | ATM_Port |
| pmReceivedAtmCells | Virtual_channel | VclTp |
| pmReceivedAtmCells | Traffic | VplTp |
| pmRemoteSIBTime | MTP2_Terminating_Point | Signalling_Point |
| pmRtpDiscardedPkts | Connection_Quality | RemoteSite |
| pmRtpLostPkts | Connection_Quality | RemoteSite |
| pmRtpReceivedPkts | Connection_Quality | RemoteSite |
| pmRxFc | IMA_Link | IMA |
| pmRxFcFe | IMA_Link | IMA |
| pmRxStuffIma | IMA_Link | IMA |
| pmRxUusIma | IMA_Link | IMA |
| pmRxUusImaFe | IMA_Link | IMA |
| pmSctpAborted | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpActiveEstab | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpCurrEstab | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpPassiveEstab | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpShutdowns | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatAssocOutOfBlue | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatChecksumErrorCounter | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatCommResume | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatCommStop | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatFragmentedUserMsg | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatOutOfOrderRecChunks | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatOutOfOrderSendChunks | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatReassembledUserMsg | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatRecChunks | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatRecChunksDropped | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatReceivedControlChunks | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatReceivedPackages | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatRetransChunks | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatSentChunks | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatSentChunksDropped | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatSentControlChunks | Stream_Control_Transmission_Protocol | Sigtran |
| pmSctpStatSentPackages | Stream_Control_Transmission_Protocol | Sigtran |
| pmSecondsWithUnexp | ATM_port_utilisation | ATM_Port |
| pmSerDetected | Device_Group_Statistics | MS_Device_Group |
| pmSerDetectedTotal | DSP | MS_Processing |
| pmSes | E1_Terminating_Point | E1 |
| pmSes | T1_Terminating_Point | T1 |
| pmSes | VT15_Terminating_Point | VT15 |
| pmSesIma | IMA_Link | IMA |
| pmSesImaFe | IMA_Link | IMA |
| pmSesp | STS1_Terminating_Point | STS1 |
| pmSesp | STS3_Terminating_Point | STS3 |
| pmSidActivated | Device_Pool | MGW_Resource_Pool |
| pmSuccInConnsRemote | Connections | AAL2_Access_Point |
| pmSuccInConnsRemoteQosClassA | Connections | AAL2_Access_Point |
| pmSuccInConnsRemoteQosClassB | Connections | AAL2_Access_Point |
| pmSuccInConnsRemoteQosClassC | Connections | AAL2_Access_Point |
| pmSuccInConnsRemoteQosClassD | Connections | AAL2_Access_Point |
| pmSuccOutConnsRemote | Connections | AAL2_Access_Point |
| pmSuccOutConnsRemoteQosClassA | Connections | AAL2_Access_Point |
| pmSuccOutConnsRemoteQosClassB | Connections | AAL2_Access_Point |
| pmSuccOutConnsRemoteQosClassC | Connections | AAL2_Access_Point |
| pmSuccOutConnsRemoteQosClassD | Connections | AAL2_Access_Point |
| pmSuccTransmittedPkts | Connection_Quality | RemoteSite |
| pmSuccTransmittedPktsAtmCn | Jitter_Measurement | MGW_Resource_Pool |
| pmSuccTransmittedPktsAtmRan | Jitter_Measurement | MGW_Resource_Pool |
| pmSuccTransmittedPktsIpCn | Jitter_Measurement | MGW_Resource_Pool |
| pmSyncTransFaxModemGsm | GSM_CSD_Fax_Pool | MGW_Resource_Pool |
| pmSyncTransModemGsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmTfoAmrNbDroppedCalls | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoAmrNbEndPointMode | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoAmrNbEstablishments | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoAmrNbFallbacks | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoAmrNbNegotiations | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoAmrNbReEstablishments | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoAmrNbReNegotiations | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoEfrDroppedCalls | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoEfrEndPointMode | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoEfrEstablishments | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoEfrFallbacks | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoEfrNegotiations | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoEfrReEstablishments | Tandem_Free_Op | MGW_Resource_Pool |
| pmTfoEfrReNegotiations | Tandem_Free_Op | MGW_Resource_Pool |
| pmTotalNrOfTdmTerms | Utilisation | VMGW |
| pmTotalSeizures | Device_Pool | MGW_Resource_Pool |
| pmTransmittedAtmCells | ATM_port_utilisation | ATM_Port |
| pmTransmittedAtmCells | Virtual_channel | VclTp |
| pmTransmittedAtmCells | Traffic | VplTp |
| pmTxFc | IMA_Link | IMA |
| pmTxFcFe | IMA_Link | IMA |
| pmTxStuffIma | IMA_Link | IMA |
| pmTxUusIma | IMA_Link | IMA |
| pmTxUusImaFe | IMA_Link | IMA |
| pmUas | E1_Terminating_Point | E1 |
| pmUas | T1_Terminating_Point | T1 |
| pmUas | VT15_Terminating_Point | VT15 |
| pmUasIma | IMA_Link | IMA |
| pmUasImaFe | IMA_Link | IMA |
| pmUasp | STS1_Terminating_Point | STS1 |
| pmUasp | STS3_Terminating_Point | STS3 |
| pmUdiCalls | Utilisation | MGW_Resource_Pool |
| pmUdiCallsFail | Utilisation | MGW_Resource_Pool |
| pmUdiCallsSuccess | Utilisation | MGW_Resource_Pool |
| pmUdiFail | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmUdiFailGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmUdiSucc | WCDMA_CSD_Digital_Pool | MGW_Resource_Pool |
| pmUdiSuccGsm | GSM_CSD_Digital_Pool | MGW_Resource_Pool |
| pmUdpInDatagrams | IP_Payload | IP_Interface |
| pmUdpInDatagrams | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmUdpInErrors | IP_Payload | IP_Interface |
| pmUdpInErrors | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmUdpNoPorts | IP_Payload | IP_Interface |
| pmUdpNoPorts | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmUdpOutDatagrams | IP_Payload | IP_Interface |
| pmUdpOutDatagrams | Stream_Control_Transmission_Protocol_IP | Sigtran |
| pmUnRecMessages | Signalling_Messages | AAL2_Access_Point |
| pmUnRecParams | Signalling_Messages | AAL2_Access_Point |
| pmUnsuccCmm | GSM_CSD_Fax_Pool | MGW_Resource_Pool |
| pmUnsuccessfulConnsInternal | AAL2_Sig_Point | AAL2_Signalling_Point |
| pmUnSuccInConnsLocalQosClassA | Connections | AAL2_Access_Point |
| pmUnSuccInConnsLocalQosClassB | Connections | AAL2_Access_Point |
| pmUnSuccInConnsLocalQosClassC | Connections | AAL2_Access_Point |
| pmUnSuccInConnsLocalQosClassD | Connections | AAL2_Access_Point |
| pmUnSuccInConnsRemote | Connections | AAL2_Access_Point |
| pmUnSuccInConnsRemoteQosClassA | Connections | AAL2_Access_Point |
| pmUnSuccInConnsRemoteQosClassB | Connections | AAL2_Access_Point |
| pmUnSuccInConnsRemoteQosClassC | Connections | AAL2_Access_Point |
| pmUnSuccInConnsRemoteQosClassD | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsLocalQosClassA | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsLocalQosClassB | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsLocalQosClassC | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsLocalQosClassD | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsRemote | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsRemoteQosClassA | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsRemoteQosClassB | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsRemoteQosClassC | Connections | AAL2_Access_Point |
| pmUnSuccOutConnsRemoteQosClassD | Connections | AAL2_Access_Point |
| pmUnsuccSeizures | Device_Pool | MGW_Resource_Pool |
| pmUsedBandwidthForIpTransport | Service_and_software_licensing | MGW |
| pmV21 | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV21Calls | Utilisation | MGW_Resource_Pool |
| pmV21Gsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV22 | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV22bis | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV22bisCalls | Utilisation | MGW_Resource_Pool |
| pmV22bisGsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV22Calls | Utilisation | MGW_Resource_Pool |
| pmV22Gsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV27ter | GSM_CSD_Fax_Pool | MGW_Resource_Pool |
| pmV29 | GSM_CSD_Fax_Pool | MGW_Resource_Pool |
| pmV32 | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV32bis | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV32bisGsm | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV32Calls | Utilisation | MGW_Resource_Pool |
| pmV32Gsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV34 | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV34Calls | Utilisation | MGW_Resource_Pool |
| pmV34Gsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV90 | WCDMA_CSD_Modem_Pool | MGW_Resource_Pool |
| pmV90Calls | Utilisation | MGW_Resource_Pool |
| pmV90Gsm | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| pmVcBbe | VC12_Terminating_Point | VC12 |
| pmVcBbe | VC4_Terminating_Point | VC4 |
| pmVcEs | VC12_Terminating_Point | VC12 |
| pmVcEs | VC4_Terminating_Point | VC4 |
| pmVcSes | VC12_Terminating_Point | VC12 |
| pmVcSes | VC4_Terminating_Point | VC4 |
| pmVcUas | VC12_Terminating_Point | VC12 |
| pmVcUas | VC4_Terminating_Point | VC4 |
| ratio_TX_to_RX_MSU | MTP2_Terminating_Point | Signalling_Point |
| Received_Bandwitdth_Link1 | Interface_Traffic | GigabitEthernet |
| Received_Bandwitdth_Link2 | Interface_Traffic | GigabitEthernet |
| Rx_bandwidth_per_second | ATM_port_utilisation | ATM_Port |
| Rx_bandwidth_per_second | Virtual_channel | VclTp |
| Rx_bandwidth_per_second | Traffic | VplTp |
| Rx_cells_per_second | ATM_port_utilisation | ATM_Port |
| Rx_cells_per_second | Virtual_channel | VclTp |
| Rx_cells_per_second | Traffic | VplTp |
| Tot_GSM_Modem_Connect | GSM_CSD_Modem_Pool | MGW_Resource_Pool |
| Tot_IP_Datagram_Sent | GigabitEthernet_Interface | IP_Interface |
| Tot_pmNoOfERRRec | SCCP_Relay_Signalling_Point | Signalling_Point |
| Tot_pmNoOfERRSent | SCCP_Relay_Signalling_Point | Signalling_Point |
| Tot_Rcvd_IP_Datagrams | Interface_Traffic | Fast_Ethernet |
| Tot_SCCP_Msg_Rcvd | SCCP_Relay_Signalling_Point | Signalling_Point |
| Tot_SCCP_Msg_Sent | SCCP_Relay_Signalling_Point | Signalling_Point |
| Tot_SCTP_Data_Chunks_Sent | Stream_Control_Transmission_Protocol | Sigtran |
| Tot_Sent_IP_Datagram | Stream_Control_Transmission_Protocol_IP | Sigtran |
| Tot_Sent_IP_Datagrams | Interface_Traffic | Fast_Ethernet |
| Total_cells | ATM_port_utilisation | ATM_Port |
| Total_cells | Traffic | VplTp |
| TotIfInOctetsLink1 | Interface_Traffic | GigabitEthernet |
| TotIfInOctetsLink2 | Interface_Traffic | GigabitEthernet |
| TotIfInOctetsLo | Interface_Traffic | Fast_Ethernet |
| TotIfOutOctetsLink1 | Interface_Traffic | GigabitEthernet |
| TotIfOutOctetsLink2 | Interface_Traffic | GigabitEthernet |
| TotIfOutOctetsLo | Interface_Traffic | Fast_Ethernet |
| Transmitted_Bandwitdth_Link1 | Interface_Traffic | GigabitEthernet |
| Transmitted_Bandwitdth_Link2 | Interface_Traffic | GigabitEthernet |
| Tx_bandwidth_per_second | ATM_port_utilisation | ATM_Port |
| Tx_bandwidth_per_second | Virtual_channel | VclTp |
| Tx_bandwidth_per_second | Traffic | VplTp |
| Tx_cells_per_second | ATM_port_utilisation | ATM_Port |
| Tx_cells_per_second | Virtual_channel | VclTp |
| Tx_cells_per_second | Traffic | VplTp |
| Usage_rate_Rx | Virtual_channel | VclTp |
| Usage_rate_Rx | Traffic | VplTp |
| Usage_rate_Tx | Virtual_channel | VclTp |
| Usage_rate_Tx | Traffic | VplTp |
This section lists the performance indicators (both one-to-one counter mappings, and complex KPIs) that are defined in this technology pack, grouped by the network object to which they relate, as follows:
Note that all KPIs will have total, average, minimum and maximum values calculated for daily, weekly, and monthly summaries. Individual groups of KPIs may have additional summary types (including busy hours) applied to them, and these are listed against the respective KPIs in the tables below.
Terminating point error statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmBwErrBlocks}) | FLOAT | % | ||
| pmBwErrBlocks | ericsson_aal1_tp_vcc_tp_mgw_aal1tpvc_err_raw.pmbwerrblocks | INTEGER | # | Number of backward error blocks. | ermgwmsbh |
| pmBwLostCells | ericsson_aal1_tp_vcc_tp_mgw_aal1tpvc_err_raw.pmbwlostcells | INTEGER | # | Number of lost backward cells on the Virtual Channel Connections (VCC) and Virtual Path Connections (VPC). | ermgwmsbh |
| pmBwMissinsCells | ericsson_aal1_tp_vcc_tp_mgw_aal1tpvc_err_raw.pmbwmissinscells | INTEGER | # | Number of backward miss-inserted cells on the Virtual Channel Connections (VCC) and Virtual Path Connections (VPC). | ermgwmsbh |
| pmFwErrBlocks | ericsson_aal1_tp_vcc_tp_mgw_aal1tpvc_err_raw.pmfwerrblocks | INTEGER | # | Number of forward error blocks. | ermgwmsbh |
| pmFwLostCells | ericsson_aal1_tp_vcc_tp_mgw_aal1tpvc_err_raw.pmfwlostcells | INTEGER | # | Number of lost forward cells on the Virtual Channel Connections (VCC) and Virtual Path Connections (VPC). | ermgwmsbh |
| pmFwMissinsCells | ericsson_aal1_tp_vcc_tp_mgw_aal1tpvc_err_raw.pmfwmissinscells | INTEGER | # | Number of forward miss-inserted cells on the Virtual Channel Connections (VCC) and Virtual Path Connections (VPC). | ermgwmsbh |
| pmLostBrCells | ericsson_aal1_tp_vcc_tp_mgw_aal1tpvc_err_raw.pmlostbrcells | INTEGER | # | Number of lost Backward Reporting (BR) cells. | ermgwmsbh |
| pmLostFpmCells | ericsson_aal1_tp_vcc_tp_mgw_aal1tpvc_err_raw.pmlostfpmcells | INTEGER | # | Number of lost Forward Performance Monitoring (FPM) cells. | ermgwmsbh |
Connection data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_AAL2_Pipe_Utilization | percentok(({pmExisOrigConns}+{pmExisTermConns}+{pmExisTransConns}),{AAL2_Pipe_Utilization_denom}) | FLOAT | % | AAL2 pipe utilization rate | ermgwmsbh |
| %_data_coverage | getvalidity({pmExisOrigConns}) | FLOAT | % | ||
| %_Incoming_AAL2_Conn_Rsrv | percentok({pmSuccInConnsRemoteQosClassA},({pmSuccInConnsRemoteQosClassA}+{pmUnSuccInConnsRemoteQosClassA})) | FLOAT | % | Incoming AAL2 connection reservation success rate | ermgwmsbh |
| %_Outgoing_AAL2_Conn_Rsrv | percentok({pmSuccOutConnsRemoteQosClassA},({pmSuccOutConnsRemoteQosClassA}+{pmUnSuccOutConnsRemoteQosClassA})) | FLOAT | % | Outgoing AAL2 connection reservation success rate | ermgwmsbh |
| %_pmSuccInConnsRemote | percentok({pmSuccInConnsRemote},({pmSuccInConnsRemote}+{pmUnSuccInConnsRemote})) | FLOAT | % | Obsolete in R4.1:Connection success rate of incoming connections on the AP. | ermgwmsbh |
| %_pmSuccOutConnsRemote | percentok({pmSuccOutConnsRemote},({pmSuccOutConnsRemote}+{pmUnSuccOutConnsRemote})) | FLOAT | % | Obsolete in R4.1:Connection success rate of outgoing connections from the AP. | ermgwmsbh |
| AAL2_Pipe_Utilization_denom | ericsson_aal2_access_point_connections_3_raw.aal2_pipe_utilization_denom | INTEGER | # | AAL2_Pipe_Utilization_denom | ermgwmsbh |
| nrOfConfiguredAal2Paths | ericsson_aal2_access_point_connections_3_raw.nrofconfiguredaal2paths | INTEGER | # | The total number of Aal2PathVccTp Mos configured on this Aal2 Ap | ermgwmsbh |
| nrOfUnavailableAal2Paths | ericsson_aal2_access_point_connections_3_raw.nrofunavailableaal2paths | INTEGER | # | The total number of unavailable Aal2PathVccTp on this Aal2 Ap | ermgwmsbh |
| pmExisOrigConns | ericsson_aal2_access_point_connections_raw.pmexisorigconns | INTEGER | # | Current number of existing connections for the Access Point (AP) originating in this node. | ermgwmsbh |
| pmExisTermConns | ericsson_aal2_access_point_connections_raw.pmexistermconns | INT8 | # | Current number of existing connections for the AP terminating in this node. | ermgwmsbh |
| pmExisTransConns | ericsson_aal2_access_point_connections_raw.pmexistransconns | INT8 | # | Current number of existing connections for the AP transiting in this node. | ermgwmsbh |
| pmSuccInConnsRemote | ericsson_aal2_access_point_connections_raw.pmsuccinconnsremote | INT8 | # | Obsolete in R4.1:Total number of successful establishment of incoming connections on the AP. | ermgwmsbh |
| pmSuccInConnsRemoteQosClassA | ericsson_aal2_access_point_connections_2_raw.pmsuccinconnsremoteqosclassa | INTEGER | # | Number of successful establishments of incoming connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmSuccInConnsRemoteQosClassB | ericsson_aal2_access_point_connections_2_raw.pmsuccinconnsremoteqosclassb | INTEGER | # | Number of successful establishments of incoming connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmSuccInConnsRemoteQosClassC | ericsson_aal2_access_point_connections_2_raw.pmsuccinconnsremoteqosclassc | INTEGER | # | Number of successful establishments of incoming connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmSuccInConnsRemoteQosClassD | ericsson_aal2_access_point_connections_2_raw.pmsuccinconnsremoteqosclassd | INTEGER | # | Number of successful establishments of incoming connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmSuccOutConnsRemote | ericsson_aal2_access_point_connections_raw.pmsuccoutconnsremote | INT8 | # | Obsolete in R4.1:Current number of successful establishment of outgoing connections from the AP. | ermgwmsbh |
| pmSuccOutConnsRemoteQosClassA | ericsson_aal2_access_point_connections_2_raw.pmsuccoutconnsremoteqosclassa | INTEGER | # | Number of successful establishments of outgoing connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmSuccOutConnsRemoteQosClassB | ericsson_aal2_access_point_connections_2_raw.pmsuccoutconnsremoteqosclassb | INTEGER | # | Number of successful establishments of outgoing connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmSuccOutConnsRemoteQosClassC | ericsson_aal2_access_point_connections_2_raw.pmsuccoutconnsremoteqosclassc | INTEGER | # | Number of successful establishments of outgoing connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmSuccOutConnsRemoteQosClassD | ericsson_aal2_access_point_connections_2_raw.pmsuccoutconnsremoteqosclassd | INTEGER | # | Number of successful establishments of outgoing connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmUnSuccInConnsLocalQosClassA | ericsson_aal2_access_point_connections_2_raw.pmunsuccinconnslocalqosclassa | INTEGER | # | Number of unsuccessful attempts to allocate AAL2 path resources (Common Part Sublayer) during establishment of incoming connections on this Access Point (AP) caused by Channel Identifier (CID) and/or bandwidth collision or mismatch of Call Admission Control (CAC) between peers. | ermgwmsbh |
| pmUnSuccInConnsLocalQosClassB | ericsson_aal2_access_point_connections_2_raw.pmunsuccinconnslocalqosclassb | INTEGER | # | Number of unsuccessful attempts to allocate AAL2 path resources (Common Part Sublayer) during establishment of incoming connections on this Access Point (AP) caused by Channel Identifier (CID) and/or bandwidth collision or mismatch of Call Admission Control (CAC) between peers. | ermgwmsbh |
| pmUnSuccInConnsLocalQosClassC | ericsson_aal2_access_point_connections_2_raw.pmunsuccinconnslocalqosclassc | INTEGER | # | Number of unsuccessful attempts to allocate AAL2 path resources (Common Part Sublayer) during establishment of incoming connections on this Access Point (AP) caused by Channel Identifier (CID) and/or bandwidth collision or mismatch of Call Admission Control (CAC) between peers. | ermgwmsbh |
| pmUnSuccInConnsLocalQosClassD | ericsson_aal2_access_point_connections_2_raw.pmunsuccinconnslocalqosclassd | INTEGER | # | Number of unsuccessful attempts to allocate AAL2 path resources (Common Part Sublayer) during establishment of incoming connections on this Access Point (AP) caused by Channel Identifier (CID) and/or bandwidth collision or mismatch of Call Admission Control (CAC) between peers. | ermgwmsbh |
| pmUnSuccInConnsRemote | ericsson_aal2_access_point_connections_raw.pmunsuccinconnsremote | INT8 | # | Obsolete in R4.1:Total number of unsuccessful establishment of incoming connections from the AP. | ermgwmsbh |
| pmUnSuccInConnsRemoteQosClassA | ericsson_aal2_access_point_connections_2_raw.pmunsuccinconnsremoteqosclassa | INTEGER | # | Number of unsuccessful establishments of incoming connections on this AAL2 Access Point caused by the reject from the AAL2 Access Point in the remote node. | ermgwmsbh |
| pmUnSuccInConnsRemoteQosClassB | ericsson_aal2_access_point_connections_3_raw.pmunsuccinconnsremoteqosclassb | INTEGER | # | Number of unsuccessful establishments of incoming connections on this AAL2 Access Point caused by the reject from the AAL2 Access Point in the remote node. | ermgwmsbh |
| pmUnSuccInConnsRemoteQosClassC | ericsson_aal2_access_point_connections_3_raw.pmunsuccinconnsremoteqosclassc | INTEGER | # | Number of unsuccessful establishments of incoming connections on this AAL2 Access Point caused by the reject from the AAL2 Access Point in the remote node. | ermgwmsbh |
| pmUnSuccInConnsRemoteQosClassD | ericsson_aal2_access_point_connections_3_raw.pmunsuccinconnsremoteqosclassd | INTEGER | # | Number of unsuccessful establishments of incoming connections on this AAL2 Access Point caused by the reject from the AAL2 Access Point in the remote node. | ermgwmsbh |
| pmUnSuccOutConnsLocalQosClassA | ericsson_aal2_access_point_connections_3_raw.pmunsuccoutconnslocalqosclassa | INTEGER | # | Number of unsuccessful attempts to allocate AAL2 resources (Common Part sublayer) during establishment of outgoing connections on this Access Point (AP). | ermgwmsbh |
| pmUnSuccOutConnsLocalQosClassB | ericsson_aal2_access_point_connections_3_raw.pmunsuccoutconnslocalqosclassb | INTEGER | # | Number of unsuccessful attempts to allocate AAL2 resources (Common Part sublayer) during establishment of outgoing connections on this Access Point (AP). | ermgwmsbh |
| pmUnSuccOutConnsLocalQosClassC | ericsson_aal2_access_point_connections_3_raw.pmunsuccoutconnslocalqosclassc | INTEGER | # | Number of unsuccessful attempts to allocate AAL2 resources (Common Part sublayer) during establishment of outgoing connections on this Access Point (AP). | ermgwmsbh |
| pmUnSuccOutConnsLocalQosClassD | ericsson_aal2_access_point_connections_3_raw.pmunsuccoutconnslocalqosclassd | INTEGER | # | Number of unsuccessful attempts to allocate AAL2 resources (Common Part sublayer) during establishment of outgoing connections on this Access Point (AP). | ermgwmsbh |
| pmUnSuccOutConnsRemote | ericsson_aal2_access_point_connections_raw.pmunsuccoutconnsremote | INT8 | # | Obsolete in R4.1:Total number of unsuccessful establishment of outgoing connections from the AP. | ermgwmsbh |
| pmUnSuccOutConnsRemoteQosClassA | ericsson_aal2_access_point_connections_3_raw.pmunsuccoutconnsremoteqosclassa | INTEGER | # | Number of unsuccessful establishments of outgoing connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmUnSuccOutConnsRemoteQosClassB | ericsson_aal2_access_point_connections_3_raw.pmunsuccoutconnsremoteqosclassb | INTEGER | # | Number of unsuccessful establishments of outgoing connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmUnSuccOutConnsRemoteQosClassC | ericsson_aal2_access_point_connections_3_raw.pmunsuccoutconnsremoteqosclassc | INTEGER | # | Number of unsuccessful establishments of outgoing connections on this AAL2 Access Point (AP). | ermgwmsbh |
| pmUnSuccOutConnsRemoteQosClassD | ericsson_aal2_access_point_connections_3_raw.pmunsuccoutconnsremoteqosclassd | INTEGER | # | Number of unsuccessful establishments of outgoing connections on this AAL2 Access Point (AP). | ermgwmsbh |
AAL2 Access point signalling message statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmUnRecMessages}) | FLOAT | % | ||
| pmUnRecMessages | ericsson_aal2_access_point_mgw_aal2ap_sm_raw.pmunrecmessages | INTEGER | # | Number of received unrecognized Q.2630 messages on this Access Point (AP). | ermgwmsbh |
| pmUnRecParams | ericsson_aal2_access_point_mgw_aal2ap_sm_raw.pmunrecparams | INTEGER | # | Number of received Q.2630 messages with unrecognized parameters on this Access Point (AP). | ermgwmsbh |
AAL2 Signalling point data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmUnsuccessfulConnsInternal}) | FLOAT | % | ||
| pmUnsuccessfulConnsInternal | ericsson_aal2_signalling_point_aal2_signalling_point_raw.pmunsuccessfulconnsinternal | INT8 | # | Total number of unsuccessful attempts to establish connections due to node internal problems. | ermgwmsbh |
AAL2 Common Part Sublayer
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmDiscardedEgressCpsPackets}) | FLOAT | % | ||
| pmDiscardedEgressCpsPackets | ericsson_aal2pathvcctp_mgw_aal2cps_raw.pmdiscardedegresscpspackets | INTEGER | # | Number of discarded AAL2 CPS packets in egress direction. | ermgwmsbh |
| pmEgressCpsPackets | ericsson_aal2pathvcctp_mgw_aal2cps_raw.pmegresscpspackets | INTEGER | # | Number of AAL2 CPS egress packets sent. | ermgwmsbh |
| pmIngressCpsPackets | ericsson_aal2pathvcctp_mgw_aal2cps_raw.pmingresscpspackets | INTEGER | # | Number of AAL2 CPS ingress packets received. | ermgwmsbh |
Error data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmBwErrBlocks}) | FLOAT | % | ||
| pmBwErrBlocks | ericsson_aal2pathvcctp_errors_raw.pmbwerrblocks | INT8 | # | Total number of backward errored blocks. | ermgwmsbh |
| pmBwLostCells | ericsson_aal2pathvcctp_errors_raw.pmbwlostcells | INT8 | # | Total number of lost backward cells. | ermgwmsbh |
| pmBwMissinCells | ericsson_aal2pathvcctp_errors_raw.pmbwmissincells | INT8 | # | Obsolete in R4.1:The number of misinserted backward cells. This counter is no longer supported after R2. | ermgwmsbh |
| pmBwMissinsCells | ericsson_aal2pathvcctp_errors_raw.pmbwmissinscells | INT8 | # | Total number of misinserted backward cells. | ermgwmsbh |
| pmFwErrBlocks | ericsson_aal2pathvcctp_errors_raw.pmfwerrblocks | INT8 | # | Total number of forward errored blocks. | ermgwmsbh |
| pmFwLostCells | ericsson_aal2pathvcctp_errors_raw.pmfwlostcells | INT8 | # | Total number of lost forward cells. | ermgwmsbh |
| pmFwMissinCells | ericsson_aal2pathvcctp_errors_raw.pmfwmissincells | INT8 | # | Obsolete in R4.1:The number of forward misinserted cells. This counter is no longer supported after R2. | ermgwmsbh |
| pmFwMissinsCells | ericsson_aal2pathvcctp_errors_raw.pmfwmissinscells | INT8 | # | Total number of forward misinserted cells. | ermgwmsbh |
| pmLostBrCells | ericsson_aal2pathvcctp_errors_raw.pmlostbrcells | INT8 | # | Total number of lost backward reporting cells. | ermgwmsbh |
| pmLostFpmCells | ericsson_aal2pathvcctp_errors_raw.pmlostfpmcells | INT8 | # | Total number of lost forward performance monitoring cells. | ermgwmsbh |
Terminating point error statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmBwErrBlocks}) | FLOAT | % | ||
| pmBwErrBlocks | ericsson_aal5_tp_vcc_tp_mgw_aal5tpvc_err_raw.pmbwerrblocks | INTEGER | # | Number of backward errored blocks. | ermgwmsbh |
| pmBwLostCells | ericsson_aal5_tp_vcc_tp_mgw_aal5tpvc_err_raw.pmbwlostcells | INTEGER | # | Number of lost backward cells on the Virtual Channel Connections (VCC) and Virtual Path Connections (VPC). | ermgwmsbh |
| pmBwMissinsCells | ericsson_aal5_tp_vcc_tp_mgw_aal5tpvc_err_raw.pmbwmissinscells | INTEGER | # | Number of backward miss-inserted cells on the Virtual Channel Connections (VCC) and Virtual Path Connections (VPC). | ermgwmsbh |
| pmFwErrBlocks | ericsson_aal5_tp_vcc_tp_mgw_aal5tpvc_err_raw.pmfwerrblocks | INTEGER | # | Number of forward errored blocks. | ermgwmsbh |
| pmFwLostCells | ericsson_aal5_tp_vcc_tp_mgw_aal5tpvc_err_raw.pmfwlostcells | INTEGER | # | Number of lost forward cells on the Virtual Channel Connections (VCC) and Virtual Path Connections (VPC). | ermgwmsbh |
| pmFwMissinsCells | ericsson_aal5_tp_vcc_tp_mgw_aal5tpvc_err_raw.pmfwmissinscells | INTEGER | # | Number of forward miss-inserted cells on the Virtual Channel Connections (VCC) and Virtual Path Connections (VPC). | ermgwmsbh |
| pmLostBrCells | ericsson_aal5_tp_vcc_tp_mgw_aal5tpvc_err_raw.pmlostbrcells | INTEGER | # | Number of lost Backward Reporting (BR) cells. | ermgwmsbh |
| pmLostFpmCells | ericsson_aal5_tp_vcc_tp_mgw_aal5tpvc_err_raw.pmlostfpmcells | INTEGER | # | Number of lost Forward Performance Monitoring (FPM) cells. | ermgwmsbh |
Utilisation data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_ATM_Port_Rcvd_Usage | ericsson_atm_port_atm_port_utilisation_2_raw.atm_port_rcvd_usage_pc | FLOAT | % | Port usage rate of received ATM cells | eraputctbh, ermgwmsbh |
| %_ATM_Port_Sent_Usage | ericsson_atm_port_atm_port_utilisation_2_raw.atm_port_sent_usage_pc | FLOAT | % | Port usage rate of sent ATM cells | eraputctbh, ermgwmsbh |
| %_data_coverage | getvalidity({Rx_cells_per_second}) | FLOAT | % | ||
| pmReceivedAtmCells | ericsson_atm_port_atm_port_utilisation_raw.pmreceivedatmcells | INT8 | # | Number of ATM cells received through the ATM port. | eraputctbh, ermgwmsbh |
| pmSecondsWithUnexp | ericsson_atm_port_atm_port_utilisation_2_raw.pmsecondswithunexp | INTEGER | Seconds | Number of errored seconds with discarded cells due to protocol errors, unexpected events (UNEX). I.610: | eraputctbh, ermgwmsbh |
| pmTransmittedAtmCells | ericsson_atm_port_atm_port_utilisation_raw.pmtransmittedatmcells | INT8 | # | Number of ATM cells transmitted through the ATM port. | eraputctbh, ermgwmsbh |
| Rx_bandwidth_per_second | ericsson_atm_port_atm_port_utilisation_raw.rx_bandwidth_per_second | FLOAT | # | The amount of received bandwidth per second | eraputctbh, ermgwmsbh |
| Rx_cells_per_second | ericsson_atm_port_atm_port_utilisation_raw.rx_cells_per_second | FLOAT | # | The number of received cells per second | eraputctbh, ermgwmsbh |
| Total_cells | ericsson_atm_port_atm_port_utilisation_raw.total_cells | INT8 | # | Total number of ATM cells transmitted and received through the ATM Port | eraputctbh, ermgwmsbh |
| Tx_bandwidth_per_second | ericsson_atm_port_atm_port_utilisation_raw.tx_bandwidth_per_second | FLOAT | # | The amount of transmitted bandwidth per second | eraputctbh, ermgwmsbh |
| Tx_cells_per_second | ericsson_atm_port_atm_port_utilisation_raw.tx_cells_per_second | FLOAT | # | The number of transmitted cells per second | eraputctbh, ermgwmsbh |
Virtual path data grouped up from VPCTP level. This data has a secondary key of VPLTP.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmBwErrBlocks}) | FLOAT | % | ||
| pmBwErrBlocks | ericsson_atm_port_vpgfvpctp_raw.pmbwerrblocks | INT8 | # | Total number of backward errored blocks, aggregated to vpltp level from vpctp. | eraputctbh, ermgwmsbh |
| pmBwLostCells | ericsson_atm_port_vpgfvpctp_raw.pmbwlostcells | INT8 | # | Total number of lost backward cells, aggregated to vpltp level from vpctp. | eraputctbh, ermgwmsbh |
| pmBwMissinsCells | ericsson_atm_port_vpgfvpctp_raw.pmbwmissinscells | INT8 | # | Total number of misinserted backward cells, aggregated to vpltp level from vpctp. | eraputctbh, ermgwmsbh |
| pmFwErrBlocks | ericsson_atm_port_vpgfvpctp_raw.pmfwerrblocks | INT8 | # | Total number of forward errored blocks, aggregated to vpltp level from vpctp. | eraputctbh, ermgwmsbh |
| pmFwLostCells | ericsson_atm_port_vpgfvpctp_raw.pmfwlostcells | INT8 | # | Total number of lost forward cells, aggregated to vpltp level from vpctp. | eraputctbh, ermgwmsbh |
| pmFwMissinsCells | ericsson_atm_port_vpgfvpctp_raw.pmfwmissinscells | INT8 | # | Total number of forward misinserted cells, aggregated to vpltp level from vpctp. | eraputctbh, ermgwmsbh |
| pmLostBrCells | ericsson_atm_port_vpgfvpctp_raw.pmlostbrcells | INT8 | # | Total number of lost backward reporting cells, aggregated to vpltp level from vpctp. | eraputctbh, ermgwmsbh |
| pmLostFpmCells | ericsson_atm_port_vpgfvpctp_raw.pmlostfpmcells | INT8 | # | Total number of lost Forward Performance Monitoring (FPM) cells, aggregated to vpltp level from vpctp. | eraputctbh, ermgwmsbh |
ATM Traffic configuration data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({egressAtmPcr}) | FLOAT | % | ||
| egressAtmMcr | ericsson_atmtrafficdescriptor_mgw_atmtrafdes_raw.egressatmmcr | INTEGER | Cell/s | Egress ATM minimum desired cell rate. | ermgwmsbh |
| egressAtmPcr | ericsson_atmtrafficdescriptor_mgw_atmtrafdes_raw.egressatmpcr | INTEGER | Cell/s | Egress ATM Peak cell rate (cells/s). | ermgwmsbh |
| egressAtmQos | ericsson_atmtrafficdescriptor_mgw_atmtrafdes_raw.egressatmqos | INTEGER | # | Egress ATM quality of service. | ermgwmsbh |
| ingressAtmMcr | ericsson_atmtrafficdescriptor_mgw_atmtrafdes_raw.ingressatmmcr | INTEGER | Cell/s | Ingress minimum desired cell rate (cells/s). | ermgwmsbh |
| ingressAtmPcr | ericsson_atmtrafficdescriptor_mgw_atmtrafdes_raw.ingressatmpcr | INTEGER | Cell/s | Ingress ATM Peak cell rate (cells/s). | ermgwmsbh |
| ingressAtmQos | ericsson_atmtrafficdescriptor_mgw_atmtrafdes_raw.ingressatmqos | INTEGER | # | Ingress ATM quality of service. | ermgwmsbh |
E1 termination point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmEs}) | FLOAT | % | ||
| pmEs | ericsson_e1_e1_terminating_point_raw.pmes | INT8 | seconds | Total number of Errored Seconds. | ermgwmsbh |
| pmSes | ericsson_e1_e1_terminating_point_raw.pmses | INT8 | seconds | Total number of Severely Errored Seconds. | ermgwmsbh |
| pmUas | ericsson_e1_e1_terminating_point_2_raw.pmuas | INTEGER | Seconds | Transmission Unavailable Seconds (SES). | ermgwmsbh |
Active Speech Level at Rout data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmI10ValAslr}) | FLOAT | % | ||
| pmI10ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi10valaslr | INT8 | # | Total number of ASL-R measurements at -17 and -16 dbm0. | ermgwmsbh |
| pmI11ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi11valaslr | INT8 | # | Total number of ASL-R measurements at -15 and -14 dbm0. | ermgwmsbh |
| pmI12ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi12valaslr | INT8 | # | Total number of ASL-R measurements at -13 and -12 dbm0. | ermgwmsbh |
| pmI13ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi13valaslr | INT8 | # | Total number of ASL-R measurements at -11 and -10 dbm0. | ermgwmsbh |
| pmI14ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi14valaslr | INT8 | # | Total number of ASL-R measurements at -9 and -8 dbm0. | ermgwmsbh |
| pmI15ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi15valaslr | INT8 | # | Total number of ASL-R measurements at -7 and -6 dbm0. | ermgwmsbh |
| pmI16ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi16valaslr | INT8 | # | Total number of ASL-R measurements at -5 and -4 dbm0. | ermgwmsbh |
| pmI1ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi1valaslr | INT8 | # | Total number of Active Speech Level at Rout (ASL-R) measurements at -35 and -34 dbm0. | ermgwmsbh |
| pmI2ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi2valaslr | INT8 | # | Total number of ASL-R measurements at -33 and -32 dbm0. | ermgwmsbh |
| pmI3ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi3valaslr | INT8 | # | Total number of ASL-R measurements at -31 and -30 dbm0. | ermgwmsbh |
| pmI4ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi4valaslr | INT8 | # | Total number of ASL-R measurements at -29 and -28 dbm0. | ermgwmsbh |
| pmI5ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi5valaslr | INT8 | # | Total number of ASL-R measurements at -27 and -26 dbm0. | ermgwmsbh |
| pmI6ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi6valaslr | INT8 | # | Total number of ASL-R measurements at -25 and -24 dbm0. | ermgwmsbh |
| pmI7ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi7valaslr | INT8 | # | Total number of ASL-R measurements at -23 and -22 dbm0. | ermgwmsbh |
| pmI8ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi8valaslr | INT8 | # | Total number of ASL-R measurements at -21 and -20 dbm0. | ermgwmsbh |
| pmI9ValAslr | ericsson_echo_cancellation_active_speech_level_rout_raw.pmi9valaslr | INT8 | # | Total number of ASL-R measurements at -19 and -18 dbm0. | ermgwmsbh |
Active speech level at Sout data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmI10ValAsls}) | FLOAT | % | ||
| pmI10ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi10valasls | INT8 | # | Total number of ASL-S measurements at -17 and -16 dbm0. | ermgwmsbh |
| pmI11ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi11valasls | INT8 | # | Total number of ASL-S measurements at -15 and -14 dbm0. | ermgwmsbh |
| pmI12ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi12valasls | INT8 | # | Total number of ASL-S measurements at -13 and -12 dbm0. | ermgwmsbh |
| pmI13ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi13valasls | INT8 | # | Total number of ASL-S measurements at -11 and -10 dbm0. | ermgwmsbh |
| pmI14ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi14valasls | INT8 | # | Total number of ASL-S measurements at -9 and -8 dbm0. | ermgwmsbh |
| pmI15ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi15valasls | INT8 | # | Total number of ASL-S measurements at -7 and -6 dbm0. | ermgwmsbh |
| pmI16ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi16valasls | INT8 | # | Total number of ASL-S measurements at -5 and -4 dbm0. | ermgwmsbh |
| pmI1ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi1valasls | INT8 | # | Total number of Active Speech Level at Sout (ASL-S) measurements at -35 and -34 dbm0. | ermgwmsbh |
| pmI2ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi2valasls | INT8 | # | Total number of ASL-S measurements at -33 and -32 dbm0. | ermgwmsbh |
| pmI3ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi3valasls | INT8 | # | Total number of ASL-S measurements at -31 and -30 dbm0. | ermgwmsbh |
| pmI4ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi4valasls | INT8 | # | Total number of ASL-S measurements at -29 and -28 dbm0. | ermgwmsbh |
| pmI5ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi5valasls | INT8 | # | Total number of ASL-S measurements at -27 and -26 dbm0. | ermgwmsbh |
| pmI6ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi6valasls | INT8 | # | Total number of ASL-S measurements at -25 and -24 dbm0. | ermgwmsbh |
| pmI7ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi7valasls | INT8 | # | Total number of ASL-S measurements at -23 and -22 dbm0. | ermgwmsbh |
| pmI8ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi8valasls | INT8 | # | Total number of ASL-S measurements at -21 and -20 dbm0. | ermgwmsbh |
| pmI9ValAsls | ericsson_echo_cancellation_active_speech_level_sout_raw.pmi9valasls | INT8 | # | Total number of ASL-S measurements at -19 and -18 dbm0. | ermgwmsbh |
Echo return loss data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmI10ValErl}) | FLOAT | % | ||
| pmI10ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi10valerl | INT8 | # | Total number of ERL measurements at 18 and 19 db. | ermgwmsbh |
| pmI11ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi11valerl | INT8 | # | Total number of ERL measurements at 20 and 21 db. | ermgwmsbh |
| pmI12ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi12valerl | INT8 | # | Total number of ERL measurements at 22 and 23 db. | ermgwmsbh |
| pmI13ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi13valerl | INT8 | # | Total number of ERL measurements at 24 and 25 db. | ermgwmsbh |
| pmI14ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi14valerl | INT8 | # | Total number of ERL measurements at 26 and 27 db. | ermgwmsbh |
| pmI15ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi15valerl | INT8 | # | Total number of ERL measurements at 28 and 29 db. | ermgwmsbh |
| pmI16ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi16valerl | INT8 | # | Total number of ERL measurements at 30 db. | ermgwmsbh |
| pmI1ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi1valerl | INT8 | # | Total number of Echo Return Loss (ERL) measurements at 0 and 1 db. | ermgwmsbh |
| pmI2ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi2valerl | INT8 | # | Total number of ERL measurements at 2 and 3 db. | ermgwmsbh |
| pmI3ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi3valerl | INT8 | # | Total number of ERL measurements at 4 and 5 db. | ermgwmsbh |
| pmI4ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi4valerl | INT8 | # | Total number of ERL measurements at 6 and 7 db. | ermgwmsbh |
| pmI5ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi5valerl | INT8 | # | Total number of ERL measurements at 8 and 9 db. | ermgwmsbh |
| pmI6ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi6valerl | INT8 | # | Total number of ERL measurements at 10 and 11 db. | ermgwmsbh |
| pmI7ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi7valerl | INT8 | # | Total number of ERL measurements at 12 and 13 db. | ermgwmsbh |
| pmI8ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi8valerl | INT8 | # | Total number of ERL measurements at 14 and 15 db. | ermgwmsbh |
| pmI9ValErl | ericsson_echo_cancellation_echo_return_loss_raw.pmi9valerl | INT8 | # | Total number of ERL measurements at 16 and 17 db. | ermgwmsbh |
Pure delay data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmI10ValPd}) | FLOAT | % | ||
| pmI10ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi10valpd | INT8 | # | Total number of PD measurements between 72 and 79 ms. | ermgwmsbh |
| pmI11ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi11valpd | INT8 | # | Total number of PD measurements between 80 and 87 ms. | ermgwmsbh |
| pmI12ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi12valpd | INT8 | # | Total number of PD measurements between 88 and 95 ms. | ermgwmsbh |
| pmI13ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi13valpd | INT8 | # | Total number of PD measurements between 96 and 103 ms. | ermgwmsbh |
| pmI14ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi14valpd | INT8 | # | Total number of PD measurements between 104 and 111 ms. | ermgwmsbh |
| pmI15ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi15valpd | INT8 | # | Total number of PD measurements between 112 and 119 ms. | ermgwmsbh |
| pmI16ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi16valpd | INT8 | # | Total number of PD measurements between 120 and 127 ms. | ermgwmsbh |
| pmI1ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi1valpd | INT8 | # | Total number of Pure Delay (PD) measurements between 0 and 7 ms. | ermgwmsbh |
| pmI2ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi2valpd | INT8 | # | Total number of PD measurements between 8 and 15 ms. | ermgwmsbh |
| pmI3ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi3valpd | INT8 | # | Total number of PD measurements between 16 and 23 ms. | ermgwmsbh |
| pmI4ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi4valpd | INT8 | # | Total number of PD measurements between 24 and 31 ms. | ermgwmsbh |
| pmI5ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi5valpd | INT8 | # | Total number of PD measurements between 32 and 39 ms. | ermgwmsbh |
| pmI6ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi6valpd | INT8 | # | Total number of PD measurements between 40 and 47 ms. | ermgwmsbh |
| pmI7ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi7valpd | INT8 | # | Total number of PD measurements between 48 and 55 ms. | ermgwmsbh |
| pmI8ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi8valpd | INT8 | # | Total number of PD measurements between 56 and 63 ms. | ermgwmsbh |
| pmI9ValPd | ericsson_echo_cancellation_pure_delay_raw.pmi9valpd | INT8 | # | Total number of PD measurements between 64 and 71 ms. | ermgwmsbh |
| pmNInvalid | ericsson_echo_cancellation_pure_delay_raw.pmninvalid | INT8 | # | Total number of invalid measurements. | ermgwmsbh |
Ethernet link interface statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfIfInDiscards}) | FLOAT | % | ||
| pmNoOfIfInDiscards | ericsson_ethernet_link_mgw_etherlk_raw.pmnoofifindiscards | INTEGER | # | The number of input packets discarded due to resource limitations. | ermgwmsbh |
| pmNoOfIfInErrors | ericsson_ethernet_link_mgw_etherlk_raw.pmnoofifinerrors | INTEGER | # | The number of input packets discarded due to any error. | ermgwmsbh |
| pmNoOfIfInNUcastPkts | ericsson_ethernet_link_mgw_etherlk_raw.pmnoofifinnucastpkts | INTEGER | # | The number of input broadcast or multicast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfInUcastPkts | ericsson_ethernet_link_mgw_etherlk_raw.pmnoofifinucastpkts | INTEGER | # | The number of input unicast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfOutDiscards | ericsson_ethernet_link_mgw_etherlk_raw.pmnoofifoutdiscards | INTEGER | # | The number of outbound packets discarded due to resource limitations. | ermgwmsbh |
| pmNoOfIfOutNUcastPkts | ericsson_ethernet_link_mgw_etherlk_raw.pmnoofifoutnucastpkts | INTEGER | # | The number of output broadcast or multicast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfOutUcastPkts | ericsson_ethernet_link_mgw_etherlk_raw.pmnoofifoutucastpkts | INTEGER | # | The number of packets that higher-level protocols requested to be transmitted to a subnetwork-unicast address. | ermgwmsbh |
Fast Ethernet interface statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmIfInBroadcastPkts}) | FLOAT | % | ||
| %_Rcvd_Datagram_Discard | percentfail({pmIfInDiscards},({pmIfInBroadcastPkts}+{pmIfInMulticastPkts}+{pmIfInUcastPkts})) | FLOAT | % | The ratio of discarded, received IP datagrams | ermgwmsbh, ermpiuldbh |
| %_Rcvd_Packets_Discard | percentfail({pmIfInErrors},({pmIfInBroadcastPkts}+{pmIfInMulticastPkts}+{pmIfInUcastPkts})) | FLOAT | % | The ratio of discarded, received IP packets | ermgwmsbh, ermpiuldbh |
| %_Sent_Datagram_Discard | percentfail({pmIfOutDiscards},({pmIfOutBroadcastPkts}+{pmIfOutMulticastPkts}+{pmIfOutUcastPkts})) | FLOAT | % | The ratio of discarded, sent IP datagrams | ermgwmsbh, ermpiuldbh |
| %_Sent_Packets_Discard | percentfail({pmIfOutErrors},({pmIfOutBroadcastPkts}+{pmIfOutMulticastPkts}+{pmIfOutUcastPkts})) | FLOAT | % | The ratio of discarded, sent IP packets | ermgwmsbh, ermpiuldbh |
| Avg_Rvcd_Bandwidth | ericsson_fast_ethernet_mgw_fasethrlk_2_raw.avg_rvcd_bandwidth | FLOAT | Mbit/s | Average interface received bandwidth | ermgwmsbh, ermpiuldbh |
| Avg_Tx_Bandwidth | ericsson_fast_ethernet_mgw_fasethrlk_2_raw.avg_tx_bandwidth | FLOAT | Mbit/s | Average interface transmitted bandwidth | ermgwmsbh, ermpiuldbh |
| pmIfInBroadcastPkts | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifinbroadcastpkts | INTEGER | # | The number of broadcast packets, delivered by this sublayer to a higher (sub-)layer, that were addressed to a broadcast address at this sublayer. | ermgwmsbh, ermpiuldbh |
| pmIfInDiscards | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifindiscards | INTEGER | # | The number of inbound packets that were chosen to be discarded even though no errors had been detected that prevented them from being delivered to a higher-layer protocol. One possible reason for discarding such a packet could be to free up buffer space. | ermgwmsbh, ermpiuldbh |
| pmIfInErrors | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifinerrors | INTEGER | # | Number of input packets discarded due to any error. | ermgwmsbh, ermpiuldbh |
| pmIfInMulticastPkts | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifinmulticastpkts | INTEGER | # | The number of multicast packets, delivered by this sublayer to a higher (sub-)layer, that were addressed to a multicast address at this sublayer. | ermgwmsbh, ermpiuldbh |
| pmIfInOctetsHi | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifinoctetshi | INT8 | # | The total number of octets transmitted out from the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfInOctetsLo | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifinoctetslo | INT8 | # | The total number of octets transmitted out on the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfInUcastPkts | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifinucastpkts | INTEGER | # | The number of unicast packets, delivered by this sublayer to a higher (sub-)layer, that were not addressed to a multicast or broadcast address at this sublayer. | ermgwmsbh, ermpiuldbh |
| pmIfInUnknownProtos | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifinunknownprotos | INTEGER | # | The number of packets received that had a protocol not supported or unknown. | ermgwmsbh, ermpiuldbh |
| pmIfOutBroadcastPkts | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifoutbroadcastpkts | INTEGER | # | The total number of broadcast packets that higher-level protocols requested to be transmitted, and which were addressed to a broadcast address at this sublayer, including those that were discarded or not sent. | ermgwmsbh, ermpiuldbh |
| pmIfOutDiscards | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifoutdiscards | INTEGER | # | The number of packets requested to be transmitted, but which were discarded due to lack of resources (for example, buffer space). | ermgwmsbh, ermpiuldbh |
| pmIfOutErrors | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifouterrors | INTEGER | # | The number of packets requested to be transmitted, but which were discarded due to errors found in the packets. | ermgwmsbh, ermpiuldbh |
| pmIfOutMulticastPkts | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.pmifoutmulticastpkts | INTEGER | # | The total number of multicast packets that higher-level protocols requested to be transmitted, and which were addressed to a multicast address at this sublayer, including those that were discarded or not sent. | ermgwmsbh, ermpiuldbh |
| pmIfOutOctetsHi | ericsson_fast_ethernet_mgw_fasethrlk_2_raw.pmifoutoctetshi | INT8 | # | The total number of octets transmitted out on the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfOutOctetsLo | ericsson_fast_ethernet_mgw_fasethrlk_2_raw.pmifoutoctetslo | INT8 | # | The total number of octets transmitted out on the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfOutUcastPkts | ericsson_fast_ethernet_mgw_fasethrlk_2_raw.pmifoutucastpkts | INTEGER | # | The total number of unicast packets that higher-level protocols requested to be transmitted, and which were not addressed to a multicast or broadcast address at this sublayer, including those that were discarded or not sent. | ermgwmsbh, ermpiuldbh |
| Tot_Rcvd_IP_Datagrams | ericsson_fast_ethernet_mgw_fasethrlk_2_raw.tot_rcvd_ip_datagrams | INTEGER | # | The total number of received IP datagrams | ermgwmsbh, ermpiuldbh |
| Tot_Sent_IP_Datagrams | ericsson_fast_ethernet_mgw_fasethrlk_2_raw.tot_sent_ip_datagrams | INTEGER | # | The total number of sent IP datagrams | ermgwmsbh, ermpiuldbh |
| TotIfInOctetsLo | ericsson_fast_ethernet_mgw_fasethrlk_1_raw.totifinoctetslo | INT8 | # | Total number of octets transmitted out on the interface, including framing characters. (pmIfInOctetsHi + pmIfInOctetsLo) | ermgwmsbh, ermpiuldbh |
| TotIfOutOctetsLo | ericsson_fast_ethernet_mgw_fasethrlk_2_raw.totifoutoctetslo | INT8 | # | Total number of octets transmitted out on the interface, including framing characters. (pmIfInOctetsHi + pmIfInOctetsLo) | ermgwmsbh, ermpiuldbh |
Gigabit Interface statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmDot1qTpVlanPortInDiscardsLink1}) | FLOAT | % | ||
| pmDot1qTpVlanPortInDiscardsLink1 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmdot1qtpvlanportindiscardslink1 | INTEGER | # | The number of valid frames discarded due to VLAN reasons (e.g. VLAN id not configured). | ermgwmsbh, ermpiuldbh |
| pmDot1qTpVlanPortInDiscardsLink2 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmdot1qtpvlanportindiscardslink2 | INTEGER | # | The number of valid frames discarded due to VLAN reasons (e.g. VLAN id not configured). | ermgwmsbh, ermpiuldbh |
| pmIfInBroadcastPktsLink1 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinbroadcastpktslink1 | INTEGER | # | The number of packets received with a broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfInBroadcastPktsLink2 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinbroadcastpktslink2 | INTEGER | # | The number of packets received with a broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfInDiscardsLink1 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifindiscardslink1 | INTEGER | # | The number of received packets discarded due to lack of resources (e.g. buffer space). | ermgwmsbh, ermpiuldbh |
| pmIfInDiscardsLink2 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifindiscardslink2 | INTEGER | # | The number of received packets discarded due to lack of resources (e.g. buffer space). | ermgwmsbh, ermpiuldbh |
| pmIfInErrorsLink1 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinerrorslink1 | INTEGER | # | The number of packets received which were discarded due to errors found in the packets. | ermgwmsbh, ermpiuldbh |
| pmIfInErrorsLink2 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinerrorslink2 | INTEGER | # | The number of packets received which were discarded due to errors found in the packets. | ermgwmsbh, ermpiuldbh |
| pmIfInMulticastPktsLink1 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinmulticastpktslink1 | INTEGER | # | The number of packets received with a multicast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfInMulticastPktsLink2 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinmulticastpktslink2 | INTEGER | # | The number of packets received with a broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfInOctetsLink1Hi | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinoctetslink1hi | INT8 | # | The total number of octets received on the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfInOctetsLink1Lo | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinoctetslink1lo | INT8 | # | The total number of octets received on the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfInOctetsLink2Hi | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinoctetslink2hi | INT8 | # | The total number of octets received on the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfInOctetsLink2Lo | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinoctetslink2lo | INT8 | # | The total number of octets received on the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfInUcastPktsLink1 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinucastpktslink1 | INTEGER | # | The number of packets received which was not addressed to a broadcast or broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfInUcastPktsLink2 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinucastpktslink2 | INTEGER | # | The number of packets received which was not addressed to a broadcast or broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfInUnknownProtosLink1 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinunknownprotoslink1 | INTEGER | # | The number of packets received which had a protocol not supported or unknown. | ermgwmsbh, ermpiuldbh |
| pmIfInUnknownProtosLink2 | ericsson_gigabitethernet_mgw_gigaer_1_raw.pmifinunknownprotoslink2 | INTEGER | # | The number of packets received which had a protocol not supported or unknown. | ermgwmsbh, ermpiuldbh |
| pmIfOutBroadcastPktsLink1 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutbroadcastpktslink1 | INTEGER | # | The number of packets requested to be transmitted with a broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfOutBroadcastPktsLink2 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutbroadcastpktslink2 | INTEGER | # | The number of packets requested to be transmitted with a broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfOutDiscardsLink1 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutdiscardslink1 | INTEGER | # | The number of packets requested to be transmitted discarded due to lack of resources (e.g. buffer space). | ermgwmsbh, ermpiuldbh |
| pmIfOutDiscardsLink2 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutdiscardslink2 | INTEGER | # | The number of packets requested to be transmitted discarded due to lack of resources (e.g. buffer space). | ermgwmsbh, ermpiuldbh |
| pmIfOutErrorsLink1 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifouterrorslink1 | INTEGER | # | The number of packets requested to be transmitted discarded due to errors found in the packets. | ermgwmsbh, ermpiuldbh |
| pmIfOutErrorsLink2 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifouterrorslink2 | INTEGER | # | The number of packets requested to be transmitted discarded due to errors found in the packets. | ermgwmsbh, ermpiuldbh |
| pmIfOutMulticastPktsLink1 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutmulticastpktslink1 | INTEGER | # | The number of packets requested to be transmitted with a multicast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfOutMulticastPktsLink2 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutmulticastpktslink2 | INTEGER | # | The number of packets requested to be transmitted with a multicast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfOutOctetsLink1Hi | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutoctetslink1hi | INT8 | # | The total number of octets transmitted out of the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfOutOctetsLink1Lo | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutoctetslink1lo | INT8 | # | The total number of octets transmitted out of the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfOutOctetsLink2Hi | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutoctetslink2hi | INT8 | # | The total number of octets transmitted out of the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfOutOctetsLink2Lo | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutoctetslink2lo | INT8 | # | The total number of octets transmitted out of the interface, including framing characters. | ermgwmsbh, ermpiuldbh |
| pmIfOutUcastPktsLink1 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutucastpktslink1 | INTEGER | # | The number of packets requested to be transmitted which was not addressed to a broadcast or broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| pmIfOutUcastPktsLink2 | ericsson_gigabitethernet_mgw_gigaer_2_raw.pmifoutucastpktslink2 | INTEGER | # | The number of packets requested to be transmitted which was not addressed to a broadcast or broadcast address delivered to a higher sub-layer. | ermgwmsbh, ermpiuldbh |
| Received_Bandwitdth_Link1 | ericsson_gigabitethernet_mgw_gigaer_2_raw.received_bandwitdth_link1 | FLOAT | Mbit/s | Average received bandwidth on link 1 | ermgwmsbh, ermpiuldbh |
| Received_Bandwitdth_Link2 | ericsson_gigabitethernet_mgw_gigaer_2_raw.received_bandwitdth_link2 | FLOAT | Mbit/s | Average received bandwidth on link 2 | ermgwmsbh, ermpiuldbh |
| TotIfInOctetsLink1 | ericsson_gigabitethernet_mgw_gigaer_1_raw.totifinoctetslink1 | INT8 | # | Link1: Total number of octets received on the interface, including framing characters. (pmIfInOctetsLink1Hi + pmIfInOctetsLink1Lo) | ermgwmsbh, ermpiuldbh |
| TotIfInOctetsLink2 | ericsson_gigabitethernet_mgw_gigaer_1_raw.totifinoctetslink2 | INT8 | # | Link2: Total number of octets received on the interface, including framing characters. (pmIfInOctetsLink2Hi + pmIfInOctetsLink2Lo) | ermgwmsbh, ermpiuldbh |
| TotIfOutOctetsLink1 | ericsson_gigabitethernet_mgw_gigaer_2_raw.totifoutoctetslink1 | INT8 | # | Link1: Total number of octets transmitted out of the interface, including framing characters. (pmIfOutOctetsLink1Hi+pmIfOutOctetsLink1Lo) | ermgwmsbh, ermpiuldbh |
| TotIfOutOctetsLink2 | ericsson_gigabitethernet_mgw_gigaer_2_raw.totifoutoctetslink2 | INT8 | # | Link2: Total number of octets transmitted out of the interface, including framing characters. (pmIfOutOctetsLink2Hi+pmIfOutOctetsLink2Lo) | ermgwmsbh, ermpiuldbh |
| Transmitted_Bandwitdth_Link1 | ericsson_gigabitethernet_mgw_gigaer_2_raw.transmitted_bandwitdth_link1 | FLOAT | Mbit/s | Average transmitted bandwidth on link 1 | ermgwmsbh, ermpiuldbh |
| Transmitted_Bandwitdth_Link2 | ericsson_gigabitethernet_mgw_gigaer_2_raw.transmitted_bandwitdth_link2 | FLOAT | Mbit/s | Average transmitted bandwidth on link 2 | ermgwmsbh, ermpiuldbh |
IMA group data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmGrFc}) | FLOAT | % | ||
| pmGrFcFe | ericsson_ima_ima_group_raw.pmgrfcfe | INT8 | # | Total number of far end group failure condition entrances. | ermgwmsbh |
| pmGrFc | ericsson_ima_ima_group_raw.pmgrfc | INT8 | # | Total number of local end group failure condition entrances. | ermgwmsbh |
| pmGrUasIma | ericsson_ima_ima_group_raw.pmgruasima | INT8 | # | Total number of one second intervals, where the Group Traffic State Machine (GTSM) is down. | ermgwmsbh |
IMA link data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmIvIma}) | FLOAT | % | ||
| pmIvIma | ericsson_ima_ima_link_raw.pmivima | INT8 | # | Total number of IMA Control Protocol (ICP) Violations. | ermgwmsbh |
| pmOifIma | ericsson_ima_ima_link_raw.pmoifima | INT8 | # | Total number of Out of IMA Frame (OIF) anomalies. | ermgwmsbh |
| pmRxFcFe | ericsson_ima_ima_link_raw.pmrxfcfe | INT8 | # | Total number of far end Rx link failures. | ermgwmsbh |
| pmRxFc | ericsson_ima_ima_link_raw.pmrxfc | INT8 | # | Total number of local end Rx link failures. | ermgwmsbh |
| pmRxStuffIma | ericsson_ima_ima_link_raw.pmrxstuffima | INT8 | # | Total number of stuff events inserted in the receive direction, except during SES-IMA or UAS-IMA conditions. | ermgwmsbh |
| pmRxUusImaFe | ericsson_ima_ima_link_raw.pmrxuusimafe | INT8 | seconds | Total number of Rx Unusable Seconds indications from the Rx far end LSM. | ermgwmsbh |
| pmRxUusIma | ericsson_ima_ima_link_raw.pmrxuusima | INT8 | seconds | Total number of Rx Unusable Seconds. | ermgwmsbh |
| pmSesImaFe | ericsson_ima_ima_link_raw.pmsesimafe | INT8 | # | Total number of one second intervals containing one or more Remote Defect Indicator for IMA (RDI-IMA) defects, except during Unavailable Seconds for IMA at far end (UASIMA-FE) conditions. | ermgwmsbh |
| pmSesIma | ericsson_ima_ima_link_raw.pmsesima | INT8 | # | Total number of one second intervals containing 30% of the ICP cells counted as IV-IMAs or one or more link defects, Loss of IMA Frame (LIF) or Link Out of Delay Synchronization (LODS) defects, except during UAS-IMA conditions. | ermgwmsbh |
| pmTxFcFe | ericsson_ima_ima_link_raw.pmtxfcfe | INT8 | # | Total number of far end Tx link failures. | ermgwmsbh |
| pmTxFc | ericsson_ima_ima_link_raw.pmtxfc | INT8 | # | Total number of local end Tx link failures. | ermgwmsbh |
| pmTxStuffIma | ericsson_ima_ima_link_raw.pmtxstuffima | INT8 | # | Total number of stuff events inserted in the transmit direction. | ermgwmsbh |
| pmTxUusImaFe | ericsson_ima_ima_link_raw.pmtxuusimafe | INT8 | seconds | Total number of Tx Unusable Second indications from the Tx far end LSM. | ermgwmsbh |
| pmTxUusIma | ericsson_ima_ima_link_raw.pmtxuusima | INT8 | seconds | Total number of Tx Unusable Seconds. | ermgwmsbh |
| pmUasImaFe | ericsson_ima_ima_link_raw.pmuasimafe | INT8 | seconds | Total number of Unavailable Seconds at far end. | ermgwmsbh |
| pmUasIma | ericsson_ima_ima_link_raw.pmuasima | INT8 | seconds | Total number of Unavailable Seconds at local end. | ermgwmsbh |
Interactive message data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmCallAttempts}) | FLOAT | % | ||
| %_pmCallAttempts | percentok({pmCallAttempts},({pmCallAttempts}+{pmFailedCallAttempts})) | FLOAT | % | Invocations success rate of this message. | ermgwmsbh |
| pmCallAttempts | ericsson_interactive_messaging_interactive_message_raw.pmcallattempts | INT8 | # | Total number of successful invocations of this message. | ermgwmsbh |
| pmFailedCallAttempts | ericsson_interactive_messaging_interactive_message_raw.pmfailedcallattempts | INT8 | # | Total number of unsuccessful invocations of this message. | ermgwmsbh |
IP on ATM link statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfIfInDiscards}) | FLOAT | % | ||
| pmNoOfIfInDiscards | ericsson_ip_atm_link_mgw_ipatmlk_raw.pmnoofifindiscards | INTEGER | # | The number of input packets discarded due to resource limitations. | ermgwmsbh |
| pmNoOfIfInErrors | ericsson_ip_atm_link_mgw_ipatmlk_raw.pmnoofifinerrors | INTEGER | # | The number of input packets discarded due to any error. | ermgwmsbh |
| pmNoOfIfInNUcastPkts | ericsson_ip_atm_link_mgw_ipatmlk_raw.pmnoofifinnucastpkts | INTEGER | # | The number of input broadcast or multicast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfInUcastPkts | ericsson_ip_atm_link_mgw_ipatmlk_raw.pmnoofifinucastpkts | INTEGER | # | The number of input unicast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfOutDiscards | ericsson_ip_atm_link_mgw_ipatmlk_raw.pmnoofifoutdiscards | INTEGER | # | The number of outbound packets discarded due to resource limitations. | ermgwmsbh |
| pmNoOfIfOutNUcastPkts | ericsson_ip_atm_link_mgw_ipatmlk_raw.pmnoofifoutnucastpkts | INTEGER | # | The number of output broadcast or multicast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfOutUcastPkts | ericsson_ip_atm_link_mgw_ipatmlk_raw.pmnoofifoutucastpkts | INTEGER | # | The number of packets that higher-level protocols requested to be transmitted to a subnetwork-unicast address. | ermgwmsbh |
GigabitEthernet interface IP statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmDot1qTpVlanPortInFrames}) | FLOAT | % | ||
| %_Rcvd_Datagram_Discard | percentfail({pmIfStatsIpInDiscards},{pmIfStatsIpInReceives}) | FLOAT | % | The ratio of discarded, received IP datagrams | ermgwmsbh |
| %_Received_IP_Packet_Err_Intf | percentfail(({pmIfStatsIpAddrErrors}+{pmIfStatsIpInHdrErrors}+{pmIfStatsIpUnknownProtos}),{pmIfStatsIpInReceives}) | FLOAT | % | The ratio of errored, received IP packets at Interface | ermgwmsbh |
| %_Sent_Datagram_Discard | percentfail({pmIfStatsIpOutDiscards},{pmIfStatsIpOutRequests}) | FLOAT | % | The ratio of discarded, sent IP datagrams | ermgwmsbh |
| pmDot1qTpVlanPortInFrames | ericsson_ip_interface_mgw_ipgiga_if_raw.pmdot1qtpvlanportinframes | INTEGER | # | The number of valid frames received on this port belonging to this VLAN and with a protocol processed by the local forwarding process. | ermgwmsbh |
| pmDot1qTpVlanPortOutFrames | ericsson_ip_interface_mgw_ipgiga_if_raw.pmdot1qtpvlanportoutframes | INTEGER | # | The number of valid frames transmitted from this port belonging to this VLAN. | ermgwmsbh |
| pmIfStatsIpAddrErrors | ericsson_ip_interface_mgw_ipgiga_if_raw.pmifstatsipaddrerrors | INTEGER | # | Number of received IP datagrams discarded due to invalid header address. | ermgwmsbh |
| pmIfStatsIpInDiscards | ericsson_ip_interface_mgw_ipgiga_if_raw.pmifstatsipindiscards | INTEGER | # | Number of received IP datagrams discarded due to resource problems (for example, lack of buffer space). | ermgwmsbh |
| pmIfStatsIpInHdrErrors | ericsson_ip_interface_mgw_ipgiga_if_raw.pmifstatsipinhdrerrors | INTEGER | # | Number of received IP datagrams with an error in the header. | ermgwmsbh |
| pmIfStatsIpInReceives | ericsson_ip_interface_mgw_ipgiga_if_raw.pmifstatsipinreceives | INTEGER | # | Number of received IP datagrams, including those with errors. | ermgwmsbh |
| pmIfStatsIpOutDiscards | ericsson_ip_interface_mgw_ipgiga_if_raw.pmifstatsipoutdiscards | INTEGER | # | The number of IP datagrams that should be sent, but which were discarded due to resource problems (for example, lack of buffer space). | ermgwmsbh |
| pmIfStatsIpOutRequests | ericsson_ip_interface_mgw_ipgiga_if_raw.pmifstatsipoutrequests | INTEGER | # | Number of IP datagrams requested by the IP user protocol to be processed for sending. | ermgwmsbh |
| pmIfStatsIpUnknownProtos | ericsson_ip_interface_mgw_ipgiga_if_raw.pmifstatsipunknownprotos | INTEGER | # | Number of IP datagrams received, with an unknown or not supported protocol. | ermgwmsbh |
| Tot_IP_Datagram_Sent | ericsson_ip_interface_mgw_ipgiga_if_raw.tot_ip_datagram_sent | INTEGER | # | The total number of sent IP datagrams | ermgwmsbh |
Payload data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmIcmpInDestUnreachs}) | FLOAT | % | ||
| %_Rcvd_Datagram_Discard | percentfail({pmIpInDiscards},{pmIpInReceives}) | FLOAT | % | The ratio of discarded, received IP datagrams | ermgwmsbh |
| %_Received_IP_Packet_Err_Host | percentfail(({pmIpInAddrErrors}+{pmIpInHdrErrors}+{pmIpInUnknownProtos}),{pmIpInReceives}) | FLOAT | % | The ratio of errored, received IP packets at Host | ermgwmsbh |
| %_Sent_Datagram_Discard | percentfail({pmIpOutDiscards},{pmIpOutRequests}) | FLOAT | % | The ratio of discarded, transmitted IP datagrams | ermgwmsbh |
| pmIcmpInDestUnreachs | ericsson_ip_interface_ip_payload_raw.pmicmpindestunreachs | INT8 | # | Total number of ICMP Destination Unreachable messages received. | ermgwmsbh |
| pmIcmpInErrors | ericsson_ip_interface_ip_payload_raw.pmicmpinerrors | INT8 | # | Total number of ICMP messages which the entity received but determined as having ICMP-specific errors. | ermgwmsbh |
| pmIcmpInMsgs | ericsson_ip_interface_ip_payload_raw.pmicmpinmsgs | INT8 | # | Total number of ICMP messages which the entity received. | ermgwmsbh |
| pmIcmpOutDestUnreachs | ericsson_ip_interface_ip_payload_raw.pmicmpoutdestunreachs | INT8 | # | Total number of ICMP Destination Unreachable messages sent. | ermgwmsbh |
| pmIcmpOutMsgs | ericsson_ip_interface_ip_payload_raw.pmicmpoutmsgs | INT8 | # | Total number of ICMP messages which this entity attempted to send. | ermgwmsbh |
| pmIpInAddrErrors | ericsson_ip_interface_ip_payload_raw.pmipinaddrerrors | INT8 | # | Total number of input datagrams discarded because the IP address in their IP headers destination field was not a valid address to be received at this entity. | ermgwmsbh |
| pmIpInDelivers | ericsson_ip_interface_ip_payload_raw.pmipindelivers | INT8 | # | Total number of input datagrams successfully delivered to IP user-protocols (including ICMP). | ermgwmsbh |
| pmIpInDiscards | ericsson_ip_interface_ip_payload_2_raw.pmipindiscards | INTEGER | # | The number of input IP datagrams, for which no problems were encountered that prevent their continued processing, but which were discarded, for example, due to lack of buffer space. Note that this counter does not include any datagrams discarded while awaiting reassembly. | ermgwmsbh |
| pmIpInHdrErrors | ericsson_ip_interface_ip_payload_raw.pmipinhdrerrors | INT8 | # | Total number of input datagrams discarded due to errors in their IP headers. | ermgwmsbh |
| pmIpInReceives | ericsson_ip_interface_ip_payload_raw.pmipinreceives | INT8 | # | Total number of input datagrams received from interfaces. | ermgwmsbh |
| pmIpInUnknownProtos | ericsson_ip_interface_ip_payload_raw.pmipinunknownprotos | INT8 | # | Total number of locally-addressed datagrams received successfully but discarded because of an unknown or unsupported protocol. | ermgwmsbh |
| pmIpOutDiscards | ericsson_ip_interface_ip_payload_2_raw.pmipoutdiscards | INTEGER | # | The number of output IP datagrams, for which no problem was encountered to prevent transmission to their destination, but which were discarded (for example, due to lack of buffer space). Note that this counter includes datagrams counted in ipForwDatagrams, if any such packets met this (discretionary) discard criterion. | ermgwmsbh |
| pmIpOutRequests | ericsson_ip_interface_ip_payload_raw.pmipoutrequests | INT8 | # | Total number of IP datagrams which local IP userprotocols (including ICMP) supplied to IP in requests for transmission. | ermgwmsbh |
| pmUdpInDatagrams | ericsson_ip_interface_ip_payload_raw.pmudpindatagrams | INT8 | # | Total number of UDP datagrams delivered to UDP users. | ermgwmsbh |
| pmUdpInErrors | ericsson_ip_interface_ip_payload_raw.pmudpinerrors | INT8 | # | Total number of received UDP datagrams that could not be delivered for reasons other than the lack of an application at the destination port. | ermgwmsbh |
| pmUdpNoPorts | ericsson_ip_interface_ip_payload_raw.pmudpnoports | INT8 | # | Total number of received UDP datagrams for which there was no application at the destination port. | ermgwmsbh |
| pmUdpOutDatagrams | ericsson_ip_interface_ip_payload_raw.pmudpoutdatagrams | INT8 | # | Total number of UDP datagrams sent from this entity. | ermgwmsbh |
IP interface statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfHdrErrors}) | FLOAT | % | ||
| pmNoOfHdrErrors | ericsson_ip_protocol_layer_mgw_ipproto_if_raw.pmnoofhdrerrors | INTEGER | # | The number of datagrams discarded due to format error. | ermgwmsbh |
| pmNoOfIpAddrErrors | ericsson_ip_protocol_layer_mgw_ipproto_if_raw.pmnoofipaddrerrors | INTEGER | # | The number of datagrams discarded due to error in the address. | ermgwmsbh |
| pmNoOfIpForwDatagrams | ericsson_ip_protocol_layer_mgw_ipproto_if_raw.pmnoofipforwdatagrams | INTEGER | # | The number of datagrams forwarded. | ermgwmsbh |
| pmNoOfIpInDiscards | ericsson_ip_protocol_layer_mgw_ipproto_if_raw.pmnoofipindiscards | INTEGER | # | The number of datagrams discarded due to resource limitations. | ermgwmsbh |
| pmNoOfIpInReceives | ericsson_ip_protocol_layer_mgw_ipproto_if_raw.pmnoofipinreceives | INTEGER | # | Total number of datagrams received. | ermgwmsbh |
| pmNoOfIpOutDiscards | ericsson_ip_protocol_layer_mgw_ipproto_if_raw.pmnoofipoutdiscards | INTEGER | # | The number of datagrams discarded due to lack of resources. | ermgwmsbh |
| pmNoOfIpReasmOKs | ericsson_ip_protocol_layer_mgw_ipproto_if_raw.pmnoofipreasmoks | INTEGER | # | The number of datagrams successfully reassembled. | ermgwmsbh |
| pmNoOfIpReasmReqds | ericsson_ip_protocol_layer_mgw_ipproto_if_raw.pmnoofipreasmreqds | INTEGER | # | The number of fragments received that need reassembly. | ermgwmsbh |
Ethernet transceiver statistics on the General Processor Board
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfDot3StatsFCSErrors}) | FLOAT | % | ||
| pmNoOfDot3StatsFCSErrors | ericsson_medium_access_unit_mgw_mau_ether_raw.pmnoofdot3statsfcserrors | INTEGER | # | The number of frames that did not pass the Frame Check Sequence (FCS) check. (When the packet is received, its value is compared with the FCS and if the package is damaged it is removed). | ermgwmsbh, ermpiuldbh |
| pmNoOfDot3StatsLateCollisions | ericsson_medium_access_unit_mgw_mau_ether_raw.pmnoofdot3statslatecollisions | INTEGER | # | The number of times that a collision was detected on the interface after the minimum length of a frame. | ermgwmsbh, ermpiuldbh |
M-MGW Accessibility and Retainability
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNrOfAal2TermsRej}) | FLOAT | % | ||
| %_MGW_Accessibility | percentok((({pmNrOfAal2TermsReq}+{pmNrOfIpTermsReq}+{pmNrOfTDMTermsReq}-{pmNrOfMediaStreamChannelsRejectedDueToCapacity})-({pmNrOfAal2TermsRej}+{pmNrOfIpTermsRej}+{pmNrOfTDMTermsRej})),({pmNrOfAal2TermsReq}+{pmNrOfIpTermsReq}+{pmNrOfTDMTermsReq}-{pmNrOfMediaStreamChannelsRejectedDueToCapacity})) | FLOAT | % | The M-MGW accessibility | ermgwmsbh |
| %_MGW_Retainability | percentok((({pmNrOfAal2TermsReq}+{pmNrOfIpTermsReq}+{pmNrOfTDMTermsReq}-{pmNrOfAal2TermsRej}-{pmNrOfIpTermsRej}-{pmNrOfTDMTermsRej})-({pmNrOfGcpNotifyCsdFaultAEst}+{pmNrOfGcpNotifySpeechFaultAEst})),({pmNrOfAal2TermsReq}+{pmNrOfIpTermsReq}+{pmNrOfTDMTermsReq}-{pmNrOfAal2TermsRej}-{pmNrOfIpTermsRej}-{pmNrOfTDMTermsRej})) | FLOAT | % | The M-MGW connection retainability | ermgwmsbh |
| pmNrOfAal2TermsRej | ericsson_mgw_mgw_acc_ret_raw.pmnrofaal2termsrej | INTEGER | # | Aggregated:Total number of unsuccessful AAL2 termination requests in this VMGw. | ermgwmsbh |
| pmNrOfAal2TermsReq | ericsson_mgw_mgw_acc_ret_raw.pmnrofaal2termsreq | INTEGER | # | Aggregated:Total number of AAL2 termination requests in this VMGw. | ermgwmsbh |
| pmNrOfGcpNotifyCsdFaultAEst | ericsson_mgw_mgw_acc_ret_raw.pmnrofgcpnotifycsdfaultaest | INTEGER | # | Aggregated:The total number of encountered Circuit Switched Data (CSD) termination faults after bearer establishment (between establishment of bearer and reception of Gateway Control Protocol (GCP) Sub, resulting in the sending of a GCP Notify message towards the MGC. | ermgwmsbh |
| pmNrOfGcpNotifySpeechFaultAEst | ericsson_mgw_mgw_acc_ret_raw.pmnrofgcpnotifyspeechfaultaest | INTEGER | # | Aggregated:The total number of encountered speech termination faults after bearer establishment (between establishment of bearer and reception of Gateway Control Protocol (GCP) Sub that result in the sending of a GCP Notify message towards the Media Gateway controller (MGC). | ermgwmsbh |
| pmNrOfIpTermsRej | ericsson_mgw_mgw_acc_ret_raw.pmnrofiptermsrej | INTEGER | # | Aggregated:Total number of unsuccessful IP termination requests in this VMGw. | ermgwmsbh |
| pmNrOfIpTermsReq | ericsson_mgw_mgw_acc_ret_raw.pmnrofiptermsreq | INTEGER | # | Aggregated:Total number of IP termination requests in this VMGw. | ermgwmsbh |
| pmNrOfMediaStreamChannelsRejectedDueToCapacity | ericsson_mgw_mgw_acc_ret_raw.pmnrofmediastreamchannelsrejectedduetocapacity | INTEGER | # | (From MGW-Service_and_software_licensing KPI Group) | ermgwmsbh |
| pmNrOfTDMTermsRej | ericsson_mgw_mgw_acc_ret_raw.pmnroftdmtermsrej | INTEGER | # | Aggregated:Total number of TDM Requests Rejected in TDM Termination Group. | ermgwmsbh |
| pmNrOfTDMTermsReq | ericsson_mgw_mgw_acc_ret_raw.pmnroftdmtermsreq | INTEGER | # | Aggregated:Total Number of TDM Seizure Requests in TDM Termination Group. | ermgwmsbh |
Service and software license data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNrOfMediaStreamChannelsBusy}) | FLOAT | % | ||
| %_Emergency_Call_Success | percentok(({pmNrOfEmergencyCalls}-{pmNrOfRejEmcCalls}),{pmNrOfEmergencyCalls}) | FLOAT | % | Emergency call success rate | ermgwmsbh |
| %_Media_Stream_Channel_Seizure | percentok(({pmNrOfMediaStreamChannelsReq}-{pmNrOfMediaStreamChannelsRejectedDueToCapacity}),{pmNrOfMediaStreamChannelsReq}) | FLOAT | % | Media stream channel seizure success rate | ermgwmsbh |
| %_Media_Stream_Channel_Utilization | percentok({pmNrOfMediaStreamChannelsBusy},{maxNrOfLicMediaStreamChannels}) | FLOAT | % | Media stream channel utilization rate | ermgwmsbh |
| Current_MGW_Traffic_Load | ericsson_mgw_service_and_software_licensing_2_raw.current_mgw_traffic_load | FLOAT | # | Estimated current MGW Load | ermgwmsbh |
| maxNrOfLicMediaStreamChannels | ericsson_mgw_service_and_software_licensing_2_raw.maxnroflicmediastreamchannels | INTEGER | # | The licensed number of simultaneous media stream channels. | ermgwmsbh |
| pmNrOfEmergencyCalls | ericsson_mgw_service_and_software_licensing_2_raw.pmnrofemergencycalls | INTEGER | # | The total number of emergency call setup requests in the M-MGw node. This counter matches to the number of resource reservation requests received over Gateway Control Protocol (GCP). | ermgwmsbh |
| pmNrOfMediaStreamChannelsBusy | ericsson_mgw_service_and_software_licensing_raw.pmnrofmediastreamchannelsbusy | INT8 | # | Current number of busy media stream channels. | ermgwmsbh |
| pmNrOfMediaStreamChannelsRejectedDueToCapacity | ericsson_mgw_service_and_software_licensing_raw.pmnrofmediastreamchansrejduetocap | INT8 | # | Total number of rejected channels due to licensed capacity limit is exceeded. | ermgwmsbh |
| pmNrOfMediaStreamChannelsReq | ericsson_mgw_service_and_software_licensing_2_raw.pmnrofmediastreamchannelsreq | INTEGER | # | The total number of requested media stream channels. | ermgwmsbh |
| pmNrOfRejEmcCalls | ericsson_mgw_service_and_software_licensing_raw.pmnrofrejemccalls | INT8 | # | Total number of rejected Emergency Calls. | ermgwmsbh |
| pmNrOfRejsByStaticAdmCtrl | ericsson_mgw_service_and_software_licensing_2_raw.pmnrofrejsbystaticadmctrl | INTEGER | # | The number rejected connections due to static admission control for IP transport, see attribute maxBandwidthForIpTransport. | ermgwmsbh |
| pmUsedBandwidthForIpTransport | ericsson_mgw_service_and_software_licensing_2_raw.pmusedbandwidthforiptransport | INTEGER | kbps | IP transport bandwidth currently in use | ermgwmsbh |
Device pool data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmBusyDevices}) | FLOAT | % | ||
| %_pmBusyInstances | percentfail({pmBusyInstances},({pmTotalSeizures}-{pmUnsuccSeizures})) | FLOAT | % | Percentage utilisation of service pool | ermgwmsbh |
| %_pmTotalSeizures | percentok({pmBusyDevices},({pmTotalSeizures}-{pmUnsuccSeizures})) | FLOAT | # | Obsolete in R4.1:Percentage utilisation of device. | ermgwmsbh |
| %_Service_Reserve_Succ | percentok(({pmTotalSeizures}-{pmUnsuccSeizures}),{pmTotalSeizures}) | FLOAT | % | Service reservation success rate | ermgwmsbh |
| pmBusyDevices | ericsson_mgw_resource_pool_device_pool_raw.pmbusydevices | INT8 | # | Obsolete in R4.1:Current number of busy devices in the pool. | ermgwmsbh |
| pmBusyInstances | ericsson_mgw_resource_pool_device_pool_2_raw.pmbusyinstances | INTEGER | # | The number of service instances of the corresponding service type that are currently in use. | ermgwmsbh |
| pmForcedRelease | ericsson_mgw_resource_pool_device_pool_raw.pmforcedrelease | INT8 | # | Total number of forced device releases. | ermgwmsbh |
| pmNormalRelease | ericsson_mgw_resource_pool_device_pool_raw.pmnormalrelease | INT8 | # | Total number of normal device releases. | ermgwmsbh |
| pmSidActivated | ericsson_mgw_resource_pool_device_pool_2_raw.pmsidactivated | INTEGER | # | The number of times the Silence Descriptor (SID) has been activated. (AMR and EFR service only) | ermgwmsbh |
| pmTotalSeizures | ericsson_mgw_resource_pool_device_pool_raw.pmtotalseizures | INT8 | # | Total number of seizure attempt of devices from this device pool. | ermgwmsbh |
| pmUnsuccSeizures | ericsson_mgw_resource_pool_device_pool_raw.pmunsuccseizures | INT8 | # | Total number of failed seizure attempts due to congestion. | ermgwmsbh |
GSM CSD digital pool data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmFtmFailGsm}) | FLOAT | % | ||
| %_pmFtmSuccGsm | percentok({pmFtmSuccGsm},({pmFtmSuccGsm}+{pmFtmFailGsm})) | FLOAT | % | Seizure success rate of non-transparent FTM GSM connections. | ermgwmsbh |
| %_pmModemOSuccGsm | percentok({pmModemOSuccGsm},({pmModemOSuccGsm}+{pmModemOFailGsm})) | FLOAT | % | Seizure success rate of originating MANT GSM connections. | ermgwmsbh |
| %_pmModemTSuccGsm | percentok({pmModemTSuccGsm},({pmModemTSuccGsm}+{pmModemTFailGsm})) | FLOAT | % | Seizure success rate of terminating MANT GSM connections. | ermgwmsbh |
| %_pmUdiSuccGsm | percentok({pmUdiSuccGsm},({pmUdiSuccGsm}+{pmUdiFailGsm})) | FLOAT | % | Seizure success rate of asynchronous non-transparent UDI GSM connections. | ermgwmsbh |
| pmFtmFailGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmftmfailgsm | INT8 | # | Total number of unsuccessful, non-transparent Frame Tunnel Mode (FTM) GSM connections. | ermgwmsbh |
| pmFtmSuccGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmftmsuccgsm | INT8 | # | Total number of successful, non-transparent FTM GSM connections. | ermgwmsbh |
| pmModemOFailGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmmodemofailgsm | INT8 | # | Total number of unsuccessful originating MANT GSM connections. | ermgwmsbh |
| pmModemOSuccGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmmodemosuccgsm | INT8 | # | Total number of successful originating, MANT GSM connections. | ermgwmsbh |
| pmModemTFailGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmmodemtfailgsm | INT8 | # | Total number of unsuccessful terminating MANT GSM connections. | ermgwmsbh |
| pmModemTSuccGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmmodemtsuccgsm | INT8 | # | Total number of successful terminating, MANT GSM connections. | ermgwmsbh |
| pmNumFtmGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmnumftmgsm | INT8 | # | Current number of non-transparent FTM GSM connections. | ermgwmsbh |
| pmNumModemOGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmnummodemogsm | INT8 | # | Current number of originating MANT GSM connections. | ermgwmsbh |
| pmNumModemTGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmnummodemtgsm | INT8 | # | Current number of terminating MANT GSM connections. | ermgwmsbh |
| pmNumUdiGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmnumudigsm | INT8 | # | Current number of asynchronous non-transparent Unrestricted Digital Information (UDI) GSM connections. | ermgwmsbh |
| pmUdiFailGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmudifailgsm | INT8 | # | Total number of unsuccessful asynchronous nontransparent UDI GSM connections. | ermgwmsbh |
| pmUdiSuccGsm | ericsson_mgw_resource_pool_gsm_csd_digital_pool_raw.pmudisuccgsm | INT8 | # | Total number of successful asynchronous non-transparent UDI GSM connections. | ermgwmsbh |
GSM CSD Fax pool data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmSyncTransFaxModemGsm}) | FLOAT | % | ||
| pmSyncTransFaxModemGsm | ericsson_mgw_resource_pool_mgw_csdfax_pl_raw.pmsynctransfaxmodemgsm | INTEGER | # | The total number of synchronous transparent fax modem GSM connections. | ermgwmsbh |
| pmUnsuccCmm | ericsson_mgw_resource_pool_mgw_csdfax_pl_raw.pmunsucccmm | INTEGER | # | The number of unsuccessful Channel Mode Modification (CMM) procedures observed by the Circuit Switched Data (CSD) GSM fax device. | ermgwmsbh |
| pmV27ter | ericsson_mgw_resource_pool_mgw_csdfax_pl_raw.pmv27ter | INTEGER | # | The total number of V.27 ter GSM fax modem connections. | ermgwmsbh |
| pmV29 | ericsson_mgw_resource_pool_mgw_csdfax_pl_raw.pmv29 | INTEGER | # | The total number of V.29 GSM fax modem connections. | ermgwmsbh |
GSM CSD Modem pool data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmAsyncNonTransModemGsm}) | FLOAT | % | ||
| pmAsyncNonTransModemGsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmasyncnontransmodemgsm | INT8 | # | Total number of modem asynchronous non-transparent (MANT) GSM connections. | ermgwmsbh |
| pmAsyncTransModemGsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmasynctransmodemgsm | INT8 | # | Total number of modem asynchronous transparent (MAT) GSM connections. | ermgwmsbh |
| pmSyncTransModemGsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmsynctransmodemgsm | INT8 | # | Total number of modem synchronous transparent (MST) | ermgwmsbh |
| pmV21Gsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmv21gsm | INT8 | # | Total number of V.21 GSM connections. | ermgwmsbh |
| pmV22bisGsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmv22bisgsm | INT8 | # | Total number of V.22bis GSM connections. | ermgwmsbh |
| pmV22Gsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmv22gsm | INT8 | # | Total number of V.22 GSM connections. | ermgwmsbh |
| pmV32bis | ericsson_mgw_resource_pool_gsm_csd_modem_pool_2_raw.pmv32bis | INTEGER | # | The total number of V.32bis WCDMA connections. | ermgwmsbh |
| pmV32Gsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmv32gsm | INT8 | # | Total number of V.32 GSM connections. | ermgwmsbh |
| pmV34Gsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmv34gsm | INT8 | # | Total number of V.34 GSM connections. | ermgwmsbh |
| pmV90Gsm | ericsson_mgw_resource_pool_gsm_csd_modem_pool_raw.pmv90gsm | INT8 | # | Total number of V.90 GSM connections. | ermgwmsbh |
| Tot_GSM_Modem_Connect | ericsson_mgw_resource_pool_gsm_csd_modem_pool_2_raw.tot_gsm_modem_connect | INTEGER | # | The total number of GSM modem connections | ermgwmsbh |
Resource pool jitter measurement
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_ATM_Conn_No_Disturbance | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.atm_conn_no_disturbance_pc | FLOAT | % | The ratio of ATM connections that have had no disturbances due to jitter. | ermgwmsbh |
| %_data_coverage | getvalidity({pmAtmCnConnLatePktsRatio0}) | FLOAT | % | ||
| %_IP_Conn_No_Disturbance | percentfail((({pmIpCnConnMeasuredJitter0}+{pmIpCnConnMeasuredJitter1}+{pmIpCnConnMeasuredJitter2}+{pmIpCnConnMeasuredJitter3}+{pmIpCnConnMeasuredJitter4}+{pmIpCnConnMeasuredJitter5})-{pmIpCnConnMeasuredJitter5}),({pmIpCnConnMeasuredJitter0}+{pmIpCnConnMeasuredJitter1}+{pmIpCnConnMeasuredJitter2}+{pmIpCnConnMeasuredJitter3}+{pmIpCnConnMeasuredJitter4}+{pmIpCnConnMeasuredJitter5})) | FLOAT | % | The ratio of IP connections that have had no disturbances due to jitter. | ermgwmsbh |
| pmAtmCnConnLatePktsRatio0 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnlatepktsratio0 | INTEGER | # | The total number of ATM connections towards Core Network (CN) when jitter compensation is used and where no packet has missed its processing time slot, that is, it has not been delayed more than the configured jitter protection time. | ermgwmsbh |
| pmAtmCnConnLatePktsRatio1 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnlatepktsratio1 | INTEGER | # | The total number of ATM connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0 < R <= 0.0001. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmCnConnLatePktsRatio2 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnlatepktsratio2 | INTEGER | # | The total number of ATM connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.0001 < R <= 0.001. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmCnConnLatePktsRatio3 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnlatepktsratio3 | INTEGER | # | The total number of ATM connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.001 < R <= 0.005. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmCnConnLatePktsRatio4 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnlatepktsratio4 | INTEGER | # | The total number of ATM connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.005 < R <= 0.01. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmCnConnLatePktsRatio5 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnlatepktsratio5 | INTEGER | # | The total number of ATM connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.01 < R <= 0.03. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmCnConnLatePktsRatio6 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnlatepktsratio6 | INTEGER | # | The total number of ATM connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is R > 0.03. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmCnConnMeasuredJitter0 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnmeasuredjitter0 | INTEGER | # | The total number of ATM connections towards Core Network (CN) with measured jitter (J) is 0 ms <= J <= 0.5 ms (very low input jitter). The jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor frames are not included in the measurement. | ermgwmsbh |
| pmAtmCnConnMeasuredJitter1 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnmeasuredjitter1 | INTEGER | # | The total number of ATM connections towards Core Network (CN) with measured jitter (J) is 0.5 ms < J <= 1.0 ms (low input jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmCnConnMeasuredJitter2 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnmeasuredjitter2 | INTEGER | # | The total number of ATM connections towards Core Access Network (CN) with measured jitter (J) is 1.0 ms < J <= 2.0 ms (moderate input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmCnConnMeasuredJitter3 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnmeasuredjitter3 | INTEGER | # | The total number of ATM connections towards Core Network (CN) with measured jitter (J) is 2.0 ms < J <= 5.0 ms (high input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmCnConnMeasuredJitter4 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnmeasuredjitter4 | INTEGER | # | The total number of ATM connections towards Core Network (CN) with measured jitter (J) is 5.0 ms < J <= 8.0 ms (very high input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmCnConnMeasuredJitter5 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmcnconnmeasuredjitter5 | INTEGER | # | The total number of ATM connections towards Core Network (CN) with measured is greater than 8.0 ms (ultra high input jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmRanConnLatePktsRatio0 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmranconnlatepktsratio0 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN) when jitter compensation is used and where no packet has missed its processing time slot, that is, it has not delayed more than the configured jitter protection time. | ermgwmsbh |
| pmAtmRanConnLatePktsRatio1 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmranconnlatepktsratio1 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0 < R <= 0.0001. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmRanConnLatePktsRatio2 | ericsson_mgw_resource_pool_mgw_resrc_jitter_1_raw.pmatmranconnlatepktsratio2 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.0001 < R <= 0.001. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmRanConnLatePktsRatio3 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnlatepktsratio3 | INTEGER | # | The total number of ATM connections towards Radio Access Network(RAN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.001 < R <= 0.005. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmRanConnLatePktsRatio4 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnlatepktsratio4 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.005 < R <= 0.01. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmRanConnLatePktsRatio5 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnlatepktsratio5 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.01 < R <= 0.03. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmRanConnLatePktsRatio6 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnlatepktsratio6 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is R > 0.03. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmAtmRanConnMeasuredJitter0 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnmeasuredjitter0 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN) with measured jitter (J) is 0 ms <= J <= 0.5 ms (very low input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmRanConnMeasuredJitter1 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnmeasuredjitter1 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN) with measured jitter (J) is 0.5 ms < J <= 1.0 ms (low input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmRanConnMeasuredJitter2 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnmeasuredjitter2 | INTEGER | # | The total number of ATM connections towards Radio Network (RAN) with measured jitter (J) is 1.0 ms < J <= 2.0 ms (moderate input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmRanConnMeasuredJitter3 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnmeasuredjitter3 | INTEGER | # | The total number of ATM connections towards Radio Access Network (RAN)with measured jitter (J) is 2.0 ms < J <= 5.0 ms (high input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmAtmRanConnMeasuredJitter4 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnmeasuredjitter4 | INTEGER | # | The total number of ATM connections towards Radio Access Network with measured jitter (J) is 5.0 ms < J <= 8.0 ms (very high input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor frames are not included in the measurement. | ermgwmsbh |
| pmAtmRanConnMeasuredJitter5 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmatmranconnmeasuredjitter5 | INTEGER | # | The total number of ATM connections towards Radio Access Network with measured jitter is greater than 8.0 ms (ultra high input jitter). The jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor frames are not included in the measurement. | ermgwmsbh |
| pmIpCnConnLatePktsRatio0 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmipcnconnlatepktsratio0 | INTEGER | # | The total number of IP connections towards Core Network (CN) when jitter compensation is used and where no packet has missed its processing time slot, that is, it has not delayed more than the configured jitter protection time. | ermgwmsbh |
| pmIpCnConnLatePktsRatio1 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmipcnconnlatepktsratio1 | INTEGER | # | The total number of IP connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0 < R <= 0.0001. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmIpCnConnLatePktsRatio2 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmipcnconnlatepktsratio2 | INTEGER | # | The total number of IP connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.0001 < R <= 0.001. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmIpCnConnLatePktsRatio3 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmipcnconnlatepktsratio3 | INTEGER | # | The total number of IP connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.001 < R <= 0.005. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmIpCnConnLatePktsRatio4 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmipcnconnlatepktsratio4 | INTEGER | # | The total number of IP connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.005 < R <= 0.01. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmIpCnConnLatePktsRatio5 | ericsson_mgw_resource_pool_mgw_resrc_jitter_2_raw.pmipcnconnlatepktsratio5 | INTEGER | # | The total number of IP connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.01 < R <= 0.03. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmIpCnConnLatePktsRatio6 | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmipcnconnlatepktsratio6 | INTEGER | # | The total number of IP connections towards Core Network (CN) when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is R > 0.03. Late packet means that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmIpCnConnMeasuredJitter0 | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmipcnconnmeasuredjitter0 | INTEGER | # | The total number of IP connections towards Core Network (CN) with measured jitter (J) is 0 ms <= J <= 0.5 ms (very low input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmIpCnConnMeasuredJitter1 | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmipcnconnmeasuredjitter1 | INTEGER | # | The total number of IP connections towards Core Network (CN) with measured jitter (J) is 0.5 ms < J <= 1.0 ms (low input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmIpCnConnMeasuredJitter2 | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmipcnconnmeasuredjitter2 | INTEGER | # | The total number of IP connections towards Core Network (CN) with measured jitter (J) is 1.0 ms < J <= 2.0 ms (moderate input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmIpCnConnMeasuredJitter3 | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmipcnconnmeasuredjitter3 | INTEGER | # | The total number of IP connections towards Core Network (CN) with measured jitter (J) is 2.0 ms < J <= 5.0 ms (high input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmIpCnConnMeasuredJitter4 | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmipcnconnmeasuredjitter4 | INTEGER | # | The total number of IP connections towards Core Network (CN) with measured jitter (J) is 5.0 ms < J <= 8.0 ms (very high input Jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID)frames are not included in the measurement. | ermgwmsbh |
| pmIpCnConnMeasuredJitter5 | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmipcnconnmeasuredjitter5 | INTEGER | # | The total number of IP connections towards Core Network (CN) with measured jitter is greater than 8.0 ms (ultra high input jitter). Jitter is measured only for connections where jitter compensation has been performed. Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included in the measurement. | ermgwmsbh |
| pmLatePktsAtmCn | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmlatepktsatmcn | INTEGER | # | The total number of packets in the connections towards ATM-based Core Network (CN) where a packet has been so late that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmLatePktsAtmRan | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmlatepktsatmran | INTEGER | # | The total number of packets in the connections towards ATM-based Radio Access Network where a packet has been so late that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmLatePktsIpCn | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmlatepktsipcn | INTEGER | # | The total number of packets in the connections towards IP-based Core Network where a packet has been so late that it has missed its processing time slot, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time slot if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmSuccTransmittedPktsAtmCn | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmsucctransmittedpktsatmcn | INTEGER | # | The total number of successfully transmitted packets through the jitter compensation buffer for the connections towards ATM-based Core Network (CN). Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
| pmSuccTransmittedPktsAtmRan | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmsucctransmittedpktsatmran | INTEGER | # | The total number of successfully transmitted packets through the jitter compensation buffer for the connections towards ATM-based Radio Access Network (RAN). Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
| pmSuccTransmittedPktsIpCn | ericsson_mgw_resource_pool_mgw_resrc_jitter_3_raw.pmsucctransmittedpktsipcn | INTEGER | # | The total number of successfully transmitted packets through the jitter compensation buffer for the connections towards IP-based Core Network (CN). Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
MGW Resource Pool on Tandem Free Operation
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmTfoAmrNbDroppedCalls}) | FLOAT | % | ||
| %_TFO_Fallback_PCM_AMR_Success | percentok({pmTfoAmrNbFallbacks},({pmTfoAmrNbFallbacks}+{pmTfoAmrNbDroppedCalls})) | FLOAT | % | The Tandem Free Operation fallbacks to PCM Success Rate (AMR Codec) | ermgwmsbh |
| %_TFO_Fallback_PCM_EFR_Success | percentok({pmTfoEfrFallbacks},({pmTfoEfrFallbacks}+{pmTfoEfrDroppedCalls})) | FLOAT | % | The Tandem Free Operation fallbacks to PCM Success Rate (EFR Codec) | ermgwmsbh |
| pmTfoAmrNbDroppedCalls | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoamrnbdroppedcalls | INTEGER | # | The number of failed Tandem Free Operation (TFO) fallbacks to PCM. | ermgwmsbh |
| pmTfoAmrNbEndPointMode | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoamrnbendpointmode | INTEGER | # | The number times the Tandem Free Operation (TFO) service instance has been reserved in end point mode for Adaptive Multi Rate (AMR) narrow band codec types. | ermgwmsbh |
| pmTfoAmrNbEstablishments | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoamrnbestablishments | INTEGER | # | The number of successfully established connections based on Tandem Free Operation (TFO) negotiations with another partner for Adaptive Multi Rate (AMR) narrow band codec types. | ermgwmsbh |
| pmTfoAmrNbFallbacks | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoamrnbfallbacks | INTEGER | # | The number of Tandem Free Operation (TFO) fallbacks to PCM when using the Adaptive Multi Rate (AMR) narrow band speech codec. | ermgwmsbh |
| pmTfoAmrNbNegotiations | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoamrnbnegotiations | INTEGER | # | The number of Tandem Free Operation (TFO) negotiations with another partner for Adaptive Multi Rate (AMR) narrow band codec types. | ermgwmsbh |
| pmTfoAmrNbReEstablishments | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoamrnbreestablishments | INTEGER | # | The number of successfully established connections based on Tandem Free Operation (TFO) renegotiations with another partner for Adaptive Multi Rate (AMR) narrow band codec types. | ermgwmsbh |
| pmTfoAmrNbReNegotiations | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoamrnbrenegotiations | INTEGER | # | The number of Tandem Free Operation (TFO) renegotiations with another partner for Adaptive Multi Rate (AMR) narrow band codec types. The renegotiation is triggered after TFO fallback to PCM has occured. | ermgwmsbh |
| pmTfoEfrDroppedCalls | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoefrdroppedcalls | INTEGER | # | The number of failed Tandem Free Operation (TFO) fallbacks to PCM. | ermgwmsbh |
| pmTfoEfrEndPointMode | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoefrendpointmode | INTEGER | # | The number of times the Tandem Free Operation (TFO) service instance has been reserved in end point mode for Enhanced Full Rate (EFR) codec type. | ermgwmsbh |
| pmTfoEfrEstablishments | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoefrestablishments | INTEGER | # | The number of successfully established connections based on Tandem Free Operation (TFO) negotiations with another partner for Enhanced Full Rate (EFR) codec type. | ermgwmsbh |
| pmTfoEfrFallbacks | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoefrfallbacks | INTEGER | # | The number of Tandem Free Operation (TFO) fallbacks to PCM when using the GSM Enhanced Full Rate (EFR) speech codec. | ermgwmsbh |
| pmTfoEfrNegotiations | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoefrnegotiations | INTEGER | # | The number of Tandem Free Operation (TFO) negotiations with another partner for Enhanced Full Rate (EFR) codec type. | ermgwmsbh |
| pmTfoEfrReEstablishments | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoefrreestablishments | INTEGER | # | The number of successfully established connections based on Tandem Free Operation (TFO) renegotiations with another partner for Enhanced Full Rate (EFR)codec type. | ermgwmsbh |
| pmTfoEfrReNegotiations | ericsson_mgw_resource_pool_mgw_resrc_tfo_raw.pmtfoefrrenegotiations | INTEGER | # | The number of Tandem Free Operation (TFO) renegotiations with another partner for Enhanced Full Rate (EFR) codec type. The renegotiation is triggered after TFO fallback to PCM has occured. | ermgwmsbh |
Utilisation data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNumBitTrans}) | FLOAT | % | ||
| pmBitTransFail | ericsson_mgw_resource_pool_utilisation2_raw.pmbittransfail | INT8 | # | Obsolete in R4.1:Total Number of Unsuccessful Bit Transparent Calls. Mapping changed in R3. | ermgwmsbh |
| pmBitTransSucc | ericsson_mgw_resource_pool_utilisation2_raw.pmbittranssucc | INT8 | # | Total Number of successful Bit Transparent calls. Mapping changed in R3. | ermgwmsbh |
| pmNumBitTrans | ericsson_mgw_resource_pool_utilisation2_raw.pmnumbittrans | INT8 | # | Current Number of Bit Transparent Calls. Mapping changed in R3. | ermgwmsbh |
Utilisation data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmFtmCalls}) | FLOAT | % | ||
| pmFtmCallsFail | ericsson_mgw_resource_pool_utilisation_raw.pmftmcallsfail | INT8 | # | Obsolete in R4.1:Total Number of Unsuccessful FTM Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmFtmCalls | ericsson_mgw_resource_pool_utilisation_raw.pmftmcalls | INT8 | # | Obsolete in R4.1:Current Number of FTM Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmFtmCallsSuccess | ericsson_mgw_resource_pool_utilisation_raw.pmftmcallssuccess | INT8 | # | Obsolete in R4.1:Total Number of Successful FTM Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmHandovers | ericsson_mgw_resource_pool_utilisation_raw.pmhandovers | INT8 | # | Obsolete in R4.1:Total Number of CSD Handovers to GSM. This counter is no longer supported after R2. | ermgwmsbh |
| pmModemOrigFail | ericsson_mgw_resource_pool_utilisation_raw.pmmodemorigfail | INT8 | # | Obsolete in R4.1:Total Number of Unsuccessful Originating Modem Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmModemOrig | ericsson_mgw_resource_pool_utilisation_raw.pmmodemorig | INT8 | # | Obsolete in R4.1:Defines if IWF (Interworking Function) initiates a call (i.e. modem calls or answers). This counter is no longer supported after R2. | ermgwmsbh |
| pmModemOrigSuccess | ericsson_mgw_resource_pool_utilisation_raw.pmmodemorigsuccess | INT8 | # | Obsolete in R4.1:Total Number of Successful Originating Modem Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmModemTermFail | ericsson_mgw_resource_pool_utilisation_raw.pmmodemtermfail | INT8 | # | Obsolete in R4.1:Total Number of Unsuccessful Terminating Modem Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmModemTerm | ericsson_mgw_resource_pool_utilisation_raw.pmmodemterm | INT8 | # | Obsolete in R4.1:Defines if IWF (Interworking Function) terminates a call (i.e. modem calls or answers). This counter is no longer supported after R2. | ermgwmsbh |
| pmModemTermSuccess | ericsson_mgw_resource_pool_utilisation_raw.pmmodemtermsuccess | INT8 | # | Obsolete in R4.1:Total Number of Successful Terminating Modem Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmUdiCallsFail | ericsson_mgw_resource_pool_utilisation_raw.pmudicallsfail | INT8 | # | Obsolete in R4.1:Total Number of unsuccessful UDI calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmUdiCalls | ericsson_mgw_resource_pool_utilisation_raw.pmudicalls | INT8 | # | Obsolete in R4.1:Current Number of UDI Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmUdiCallsSuccess | ericsson_mgw_resource_pool_utilisation_raw.pmudicallssuccess | INT8 | # | Obsolete in R4.1:Total Number of Successful UDI Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmV21Calls | ericsson_mgw_resource_pool_utilisation_raw.pmv21calls | INT8 | # | Obsolete in R4.1:Total Number of V21 Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmV22bisCalls | ericsson_mgw_resource_pool_utilisation_raw.pmv22biscalls | INT8 | # | Obsolete in R4.1:Total Number of V.22bis Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmV22Calls | ericsson_mgw_resource_pool_utilisation_raw.pmv22calls | INT8 | # | Obsolete in R4.1:Total Number of V.22 Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmV32Calls | ericsson_mgw_resource_pool_utilisation_raw.pmv32calls | INT8 | # | Obsolete in R4.1:Total Number of V.32 Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmV34Calls | ericsson_mgw_resource_pool_utilisation_raw.pmv34calls | INT8 | # | Obsolete in R4.1:Total Number of V.34 Calls. This counter is no longer supported after R2. | ermgwmsbh |
| pmV90Calls | ericsson_mgw_resource_pool_utilisation_raw.pmv90calls | INT8 | # | Obsolete in R4.1:Total Number of V.90 Calls. This counter is no longer supported after R2. | ermgwmsbh |
WCDMA CSD digital pool data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmFtmFail}) | FLOAT | % | ||
| %_pmFtmSucc | percentok({pmFtmSucc},({pmFtmSucc}+{pmFtmFail})) | FLOAT | % | Seizure success rate of non-transparent FTM connections. | ermgwmsbh |
| %_pmModemOSucc | percentok({pmModemOSucc},({pmModemOSucc}+{pmModemOFail})) | FLOAT | % | Seizure success rate of originating MANT WCDMA connections. | ermgwmsbh |
| %_pmModemTSucc | percentok({pmModemTSucc},({pmModemTSucc}+{pmModemTFail})) | FLOAT | % | Seizure success rate of terminating MANT WCDMA connections. | ermgwmsbh |
| %_pmUdiSucc | percentok({pmUdiSucc},({pmUdiSucc}+{pmUdiFail})) | FLOAT | % | Seizure success rate of asynchronous non-transparent UDI WCDMA connections. | ermgwmsbh |
| pmFtmFail | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmftmfail | INT8 | # | Total number of unsuccessful, non-transparent FTM. | ermgwmsbh |
| pmFtmSucc | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmftmsucc | INT8 | # | Total number of successful non-transparent FTM WCDMA. | ermgwmsbh |
| pmModemOFail | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmmodemofail | INT8 | # | Total number of unsuccessful originating MANT WCDMA. | ermgwmsbh |
| pmModemOSucc | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmmodemosucc | INT8 | # | Total number of successful originating MANT WCDMA. | ermgwmsbh |
| pmModemTFail | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmmodemtfail | INT8 | # | Total number of unsuccessful terminating MANT WCDMA connections. | ermgwmsbh |
| pmModemTSucc | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmmodemtsucc | INT8 | # | Total number of successful terminating MANT WCDMA connections. | ermgwmsbh |
| pmNumFtm | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmnumftm | INT8 | # | Current number of non-transparent FTM WCDMA connections. | ermgwmsbh |
| pmNumModemO | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmnummodemo | INT8 | # | Current number of originating MANT WCDMA connections. | ermgwmsbh |
| pmNumModemT | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmnummodemt | INT8 | # | Current number of terminating MANT WCDMA. | ermgwmsbh |
| pmNumUdi | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmnumudi | INT8 | # | Current number of asynchronous non-transparent UDI WCDMA connections. | ermgwmsbh |
| pmUdiFail | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmudifail | INT8 | # | Total number of unsuccessful asynchronous nontransparent UDI WCDMA connections. | ermgwmsbh |
| pmUdiSucc | ericsson_mgw_resource_pool_wcdma_csd_digital_pool_raw.pmudisucc | INT8 | # | Total number of successful asynchronous non-transparent UDI WCDMA connections. | ermgwmsbh |
WCDMA CSD modem pool data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmAsyncNonTransModemWcdma}) | FLOAT | % | ||
| pmAsyncNonTransModemWcdma | ericsson_mgw_resource_pool_wcdma_csd_modem_pool_raw.pmasyncnontransmodemwcdma | INT8 | # | Total number of modem MANT WCDMA connections. | ermgwmsbh |
| pmV21 | ericsson_mgw_resource_pool_wcdma_csd_modem_pool_raw.pmv21 | INT8 | # | Total number of V.21 WCDMA connections. | ermgwmsbh |
| pmV22bis | ericsson_mgw_resource_pool_wcdma_csd_modem_pool_raw.pmv22bis | INT8 | # | Total number of V.22bis WCDMA connections. | ermgwmsbh |
| pmV22 | ericsson_mgw_resource_pool_wcdma_csd_modem_pool_raw.pmv22 | INT8 | # | Total number of V.22 WCDMA connections. | ermgwmsbh |
| pmV32bisGsm | ericsson_mgw_resource_pool_wcdma_csd_modem_pool_2_raw.pmv32bisgsm | INTEGER | # | The total number of V.32bis GSM connections. | ermgwmsbh |
| pmV32 | ericsson_mgw_resource_pool_wcdma_csd_modem_pool_raw.pmv32 | INT8 | # | Total number of V.32 WCDMA connections. | ermgwmsbh |
| pmV34 | ericsson_mgw_resource_pool_wcdma_csd_modem_pool_raw.pmv34 | INT8 | # | Total number of V.34 WCDMA connections. | ermgwmsbh |
| pmV90 | ericsson_mgw_resource_pool_wcdma_csd_modem_pool_raw.pmv90 | INT8 | # | Total number of V.90 WCDMA connections. | ermgwmsbh |
The statistics for the instance of MsDeviceGroup which represents all devices on one MSB and hence the media stream characteristics of the parent plug-in unit (PIU) instance.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmSerDetected}) | FLOAT | % | ||
| pmSerDetected | eri_ms_devicegroup_raw.pmserdetected | INT8 | # | The number of Soft Error Rate (SER) faults detected by the DSP SER supervision functionality of the corresponding MSB3 board. |
Media stream pool resource statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({capacityFailed}) | FLOAT | % | ||
| %_Device_Utilization | ericsson_ms_device_pool_pool_status_raw.device_utilization_pc | INTEGER | % | Device utilization rate | ermgwmsbh |
| capacityBusy | ericsson_ms_device_pool_pool_status_raw.capacitybusy | INTEGER | % | The fraction (%) of busy device capacity in the pool. | ermgwmsbh |
| capacityDependencyFailed | ericsson_ms_device_pool_pool_status_raw.capacitydependencyfailed | INTEGER | % | The fraction (%) of device capacity in the pool which are out of service due to dependent hardware being faulty. The total fraction (%) of faulty device capacity in the pool is the sum of capacityFailed + capacityDependencyFailed. The accuracy is (+/-)1% (percent). | ermgwmsbh |
| capacityDependencyLocked | ericsson_ms_device_pool_pool_status_raw.capacitydependencylocked | INTEGER | % | The fraction (%) of device capacity in the pool which are out of service due to the maintenance locking of dependent hardware. The accuracy is (+/-)1% (percent). | ermgwmsbh |
| capacityFailed | ericsson_ms_device_pool_pool_status_raw.capacityfailed | INTEGER | % | The total fraction (%) of device capacity in the pool, which are faulty due to faults in the devices themselves. The total fraction (%) of faulty device in the pool is the sum of capacityFailed + capacityDependencyFailed. The accuracy is (+/-)1% (percent). | ermgwmsbh |
| capacityIdle | ericsson_ms_device_pool_pool_status_raw.capacityidle | INTEGER | % | The fraction (%) of idle device capacity in the pool. | ermgwmsbh |
| capacityLevelReservedForPriorityCalls | ericsson_ms_device_pool_pool_status_raw.capacitylevelreservedforprioritycalls | INTEGER | # | Defines the level of speech resources to be reserved for priority calls, to be used in case of congestion situations among normal (not reserved for priority calls) resources. The level is given as a fraction 1/1000 (promille) of the enabled capacity in the device pool. | ermgwmsbh |
| deviceType | ericsson_ms_device_pool_pool_status_raw.devicetype | INTEGER | # | Defines the types of services in this pool. | ermgwmsbh |
| maxNrOfDevices | ericsson_ms_device_pool_pool_status_raw.maxnrofdevices | INTEGER | # | A theoretical maximum number of configured devices in the pool. | ermgwmsbh |
Media Stream Card Digital Signal Processing statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmSerDetectedTotal}) | FLOAT | % | ||
| pmSerDetectedTotal | ericsson_ms_processing_dsp_raw.pmserdetectedtotal | INTEGER | # | The total number of Soft Error Rate (SER) faults in the node detected by the Digital Signal Processor (DSP) SER supervision functionality of the MSB3 boards. | ermgwmsbh |
MTP3B Access Point MTP statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfAdjacentSPNotAccessible}) | FLOAT | % | ||
| pmNoOfAdjacentSPNotAccessible | ericsson_mtp3b_ap_mgw_mtp3bap_mtp_raw.pmnoofadjacentspnotaccessible | INTEGER | SPs | Number of Adjacent Signalling Points (SPs) that are not accessible via all possible routes. | ermgwmsbh |
| pmNoOfUserPartUnavailRec | ericsson_mtp3b_ap_mgw_mtp3bap_mtp_raw.pmnoofuserpartunavailrec | INTEGER | # | Number of received User Part Unavailable messages. | ermgwmsbh |
MTP3B Signalling route MTP statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfSecondsAccumulatedRouteUnavailable}) | FLOAT | % | ||
| pmNoOfSecondsAccumulatedRouteUnavailable | ericsson_mtp3b_sr_mgw_mtp3bsr_mtp_raw.pmnoofsecondsaccumulatedrouteunavailable | INTEGER | Seconds | The (accumulated) number of seconds the route has been unavailable. | ermgwmsbh |
ATM Adaptation Layer Signalling
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmLinkInServiceTime}) | FLOAT | % | ||
| %_SS7_Signal_Quality_ATM | percentfail((({pmNoOfSentSDUs}+{pmNoOfReceivedSDUs})-{pmNoOfAllSLFailures}),({pmNoOfSentSDUs}+{pmNoOfReceivedSDUs})) | FLOAT | % | The SS7 broadband quality over ATM | ermgwmsbh |
| pmLinkInServiceTime | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmlinkinservicetime | INTEGER | Seconds | The accumulated time (in seconds) the signalling link has been in service (in assured data transfer mode) since it was created. If the link is down, the value is 0. | ermgwmsbh |
| pmNoOfAlignmentFailures | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofalignmentfailures | INTEGER | # | Number of alignment or proving failures. This counter is increased when "alignment not successful". The counter is reset when the link is created or when the counter "overflows". | ermgwmsbh |
| pmNoOfAllSLFailures | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofallslfailures | INTEGER | # | Number of all Signalling Link failures. Is a total sum of the error counters:Number of protocol errors - Number of unsuccessfully retransmissions - Number of NoResponse - Number of other errors. | ermgwmsbh |
| pmNoOfLocalCongestions | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnooflocalcongestions | INTEGER | # | Number of local congestions. This counter is incremented when the sum of SAAL send and retransmission buffers is filled to more than what the congestionOnSet attribute is configured for. | ermgwmsbh |
| pmNoOfNoResponses | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofnoresponses | INTEGER | # | Number of no responses. Counts the number of no responses detected during the last 30 minutes. | ermgwmsbh |
| pmNoOfOtherErrors | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofothererrors | INTEGER | # | Number of other list element errors. Counts the number of other errors detected during the last 30 minutes. | ermgwmsbh |
| pmNoOfProtocolErrors | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofprotocolerrors | INTEGER | # | Number of unsolicited or inappropriate Protocol Data Units (PDU). Counts the number of protocol errors detected during the last 30 minutes. | ermgwmsbh |
| pmNoOfReceivedSDUs | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofreceivedsdus | INTEGER | # | Number of successfully received Service Data Units (SDU). Counts the number of successfully received messages from the application using SAAL. | ermgwmsbh |
| pmNoOfRemoteCongestions | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofremotecongestions | INTEGER | # | Number of remote congestions. This counter is incremented when the remote side gives SAAL no credit. Reset when the link goes InService or when the counter overflows. | ermgwmsbh |
| pmNoOfSentSDUs | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofsentsdus | INTEGER | # | Number of successfully sent Service Data Units (SDU). Counts the number of successfully sent messages to the application using SAAL. Reset when the link goes InService or the counter overflows. | ermgwmsbh |
| pmNoOfSequenceDataLosses | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofsequencedatalosses | INTEGER | # | Number of Sequences Data (SD) loss. Counts the number of SD loss detected during the last 30 minutes. | ermgwmsbh |
| pmNoOfUnsuccReTransmissions | ericsson_nni_saal_tp_mgw_nnisaal_saal_raw.pmnoofunsuccretransmissions | INTEGER | # | Number of unsuccessful retransmissions. Counts the number of unsuccessful retransmissions detected during the last 30 minutes. | ermgwmsbh |
OS155 Terminating point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmMsEs}) | FLOAT | % | ||
| pmMsBbe | ericsson_os155_os155_terminating_point_2_raw.pmmsbbe | INTEGER | # | Transmission Background Block Errors (BBE). | ermgwmsbh |
| pmMsEs | ericsson_os155_os155_terminating_point_raw.pmmses | INT8 | seconds | Total number of Errored Seconds for multiplexer section. | ermgwmsbh |
| pmMsSes | ericsson_os155_os155_terminating_point_raw.pmmsses | INT8 | seconds | Total number of Severely Errored Seconds for multiplexer section. | ermgwmsbh |
| pmMsUas | ericsson_os155_os155_terminating_point_2_raw.pmmsuas | INTEGER | Seconds | Transmission Unavailable Seconds (SES). The accumulated unavailable time in seconds during the interval. Unavailable time starts when 10 consecutive SES are detected (them being part of the unavailable time) and ends when 10 consecutive non-SES are detected. | ermgwmsbh |
OSPF Routing Protocol statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfOspfOriginateNewLsas}) | FLOAT | % | ||
| pmNoOfOspfOriginateNewLsas | ericsson_ospf_mgw_ospf_proto_raw.pmnoofospforiginatenewlsas | INTEGER | # | The number of new Link-State Advertisements (LSA) that have been originated. This number is incremented each time the router originates a new LSA. | ermgwmsbh |
| pmNoOfOspfRxNewLsas | ericsson_ospf_mgw_ospf_proto_raw.pmnoofospfrxnewlsas | INTEGER | # | The number of Link-State Advertisements (LSA) received that are determined to be new instantiations. This number does not include newer instantiations of self-originated link-state advertisements. | ermgwmsbh |
OSPF Routing Area
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfOspfSpfRuns}) | FLOAT | % | ||
| pmNoOfOspfSpfRuns | ericsson_ospf_area_mgw_ospfarea_raw.pmnoofospfspfruns | INTEGER | # | The number of times that the intra-area route table has been calculated using the link-state database for this area. This is typically done using Dijkstras algorithm. | ermgwmsbh |
OSPF Routing Interface statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfOspfIfEvents}) | FLOAT | % | ||
| pmNoOfOspfIfEvents | ericsson_ospf_interface_mgw_ospfif_raw.pmnoofospfifevents | INTEGER | # | The number of times this OSPF interface has changed its state or that an error has occurred. | ermgwmsbh |
Plug In Unit processor load
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmProcessorLoad}) | FLOAT | % | ||
| pmProcessorLoad | ericsson_plug_in_unit_mgw_piu_cpu_raw.pmprocessorload | INTEGER | % | The average CPU load during the last 5 minutes. The value is stated in percent. Implemented only on MP and BP. (MP is Main Processor and BP is Board Processor. A GPB board has an MP Other boards have a BP that communicates with an MP). | ermgwmsbh, ermpiuldbh |
Remote site connection quality
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmCallsWithRtpPacketLoss0}) | FLOAT | % | ||
| %_ECN_Received_Packet | percentfail({pmIpReceivedEcnPkts},{pmRtpReceivedPkts}) | FLOAT | % | The received ECN packet rate | ermgwmsbh |
| %_IP_User_Plane_Quality | percentfail((({pmRtpReceivedPkts}+{pmRtpLostPkts})-({pmRtpDiscardedPkts}+{pmRtpLostPkts})),({pmRtpDiscardedPkts}+{pmRtpLostPkts})) | FLOAT | % | The percentage of IP user plane quality | ermgwmsbh |
| %_RTP_Discard | percentfail({pmRtpDiscardedPkts},{pmRtpReceivedPkts}) | FLOAT | % | The RTP packet discard rate | ermgwmsbh |
| %_RTP_Loss | percentfail({pmRtpLostPkts},({pmRtpLostPkts}+{pmRtpReceivedPkts})) | FLOAT | % | The RTP packet loss rate | ermgwmsbh |
| pmCallsWithRtpPacketLoss0 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmcallswithrtppacketloss0 | INTEGER | # | The total number of connections where no packet loss on Real-time Transport Protocol (RTP) layer has been detected, that is, packet loss ratio is zero. | ermgwmsbh |
| pmCallsWithRtpPacketLoss1 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmcallswithrtppacketloss1 | INTEGER | # | The total number of connections where packet loss ratio on the Real-time Transport Protocol (RTP) layer has been less than 0.0001. | ermgwmsbh |
| pmCallsWithRtpPacketLoss2 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmcallswithrtppacketloss2 | INTEGER | # | The total number of connections where packet loss ratio on the Real-time Transport Protocol (RTP) layer has been greater than or equal to 0.0001 but less than 0.001. | ermgwmsbh |
| pmCallsWithRtpPacketLoss3 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmcallswithrtppacketloss3 | INTEGER | # | The total number of connections where packet loss ratio on the Real-time Transport Protocol (RTP) layer has been greater than or equal to 0.001 but less than 0.005. | ermgwmsbh |
| pmCallsWithRtpPacketLoss4 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmcallswithrtppacketloss4 | INTEGER | # | The total number of connections where packet loss ratio on the Real-time Transport Protocol (RTP) layer has been greater than or equal to 0.005 but less than 0.01. | ermgwmsbh |
| pmCallsWithRtpPacketLoss5 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmcallswithrtppacketloss5 | INTEGER | # | The total number of connections where packet loss ratio on the Real-time Transport Protocol (RTP) layer has been greater than or equal to 0.01 but less than 0.03. | ermgwmsbh |
| pmCallsWithRtpPacketLoss6 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmcallswithrtppacketloss6 | INTEGER | # | The total number of connections where packet loss ratio on the Real-time Transport Protocol (RTP) layer has been greater than or equal to 0.03. | ermgwmsbh |
| pmConnLatePktsRatio0 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnlatepktsratio0 | INTEGER | # | The total number of connections when jitter compensation is used and where no packets has missed its processing time, that is, it has not delayed more than the configured jitter protection time. | ermgwmsbh |
| pmConnLatePktsRatio1 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnlatepktsratio1 | INTEGER | # | The total number of connections when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0< R <= 0.0001. Late packet means that it has missed its processing time, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmConnLatePktsRatio2 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnlatepktsratio2 | INTEGER | # | The total number of connections when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.0001 < R <= 0.001. Late packet means that it has missed its processing time, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmConnLatePktsRatio3 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnlatepktsratio3 | INTEGER | # | The total number of connections when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.001 < R <= 0.005. Late packet means that it has missed its processing time, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmConnLatePktsRatio4 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnlatepktsratio4 | INTEGER | # | The total number of connections when jitter compensation is used and the ratio (R) of late packets to total number of packets through jitter compensation buffer is 0.005 < R <= 0.01. Late packet means that it has missed its processing time, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmConnLatePktsRatio5 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnlatepktsratio5 | INTEGER | # | The total number of connections when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is 0.01 < R <= 0.03. Late packet means that it has missed its processing time, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmConnLatePktsRatio6 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnlatepktsratio6 | INTEGER | # | The total number of connections when jitter compensation is used and the ratio (R) of late packets to total number of packets through the jitter compensation buffer is R > 0.03. Late packet means that it has missed its processing time, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmConnMeasuredJitter0 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnmeasuredjitter0 | INTEGER | # | The total number of connections with measured jitter (J) is 0 ms <= J <= 0.5 ms (very low input jitter). Jitter is measured only for connections where jitter compensation has been performed. The Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
| pmConnMeasuredJitter1 | ericsson_remotesite_mgw_rem_conqos_1_raw.pmconnmeasuredjitter1 | INTEGER | # | The total number of connections with measured jitter (J) is 0.5 ms < J <= 1.0 ms (low input jitter). Jitter is measured only for connections where jitter compensation has been performed. The Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
| pmConnMeasuredJitter2 | ericsson_remotesite_mgw_rem_conqos_2_raw.pmconnmeasuredjitter2 | INTEGER | # | The total number of connections with measured jitter (J) is 1.0 ms < J <= 2.0 ms (moderate input jitter). Jitter is measured only for connections where jitter compensation has been performed. The Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
| pmConnMeasuredJitter3 | ericsson_remotesite_mgw_rem_conqos_2_raw.pmconnmeasuredjitter3 | INTEGER | # | The total number of connections with measured jitter (J) is 2.0 ms < J <= 5.0 ms (high input jitter). Jitter is measured only for connections where jitter compensation has been performed. The Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
| pmConnMeasuredJitter4 | ericsson_remotesite_mgw_rem_conqos_2_raw.pmconnmeasuredjitter4 | INTEGER | # | The total number of connections with measured jitter (J) is 5.0 ms < J <= 8.0 ms (very high input jitter). Jitter is measured only for connections where jitter compensation has been performed. The Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
| pmConnMeasuredJitter5 | ericsson_remotesite_mgw_rem_conqos_2_raw.pmconnmeasuredjitter5 | INTEGER | # | The total number of connections with measured jitter is greater than 8.0 ms (ultra high input jitter). Jitter is measured only for connections where jitter compensation has been performed. The Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
| pmIpReceivedEcnPkts | ericsson_remotesite_mgw_rem_conqos_2_raw.pmipreceivedecnpkts | INTEGER | # | The total number of received ECN marked (Congestion Experienced) IP packets. The counter is stepped after connection release. | ermgwmsbh |
| pmLatePktsDueToDeJitter | ericsson_remotesite_mgw_rem_conqos_2_raw.pmlatepktsduetodejitter | INTEGER | # | The total number of packets where a packet has been so late that it has missed its processing time, that is, it is delayed more than the configured jitter protection time. The packet is, however, processed in the next scheduled processing time if there are less than 7 packets in the buffer, otherwise the packet is dropped. | ermgwmsbh |
| pmNrOfAdmCtrlRejectedConnections | ericsson_remotesite_mgw_rem_conqos_2_raw.pmnrofadmctrlrejectedconnections | INTEGER | # | The total number of rejected connections due to feature Measurement Based Connection Admission Control (MBAC) for IP Traffic. | ermgwmsbh |
| pmRtpDiscardedPkts | ericsson_remotesite_mgw_rem_conqos_2_raw.pmrtpdiscardedpkts | INTEGER | # | The number of discarded Real-time Transport Protocol (RTP) packets, that is, received RTP packets discarded due to header validity checks or due to misordered sequence numbers. | ermgwmsbh |
| pmRtpLostPkts | ericsson_remotesite_mgw_rem_conqos_2_raw.pmrtplostpkts | INTEGER | # | The total number of dropped Real-time Transport Protocol (RTP) packets. The detection of dropped packets is based on sequence numbers in the RTP header as defined in Request for Comments (RFC) 1889. | ermgwmsbh |
| pmRtpReceivedPkts | ericsson_remotesite_mgw_rem_conqos_2_raw.pmrtpreceivedpkts | INTEGER | # | The total number of received Real-time Transport Protocol (RTP) packets. | ermgwmsbh |
| pmSuccTransmittedPkts | ericsson_remotesite_mgw_rem_conqos_2_raw.pmsucctransmittedpkts | INTEGER | # | The total number of successfully transmitted packets through the jitter compensation buffer. The Adaptive Multi-rate (AMR) Silence Descriptor (SID) frames are not included. | ermgwmsbh |
MTP2 terminating point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmLocalSIBTime}) | FLOAT | % | ||
| %_SS7_Signal_Quality_TDM | percentfail((({pmNoOfMSUReceived}+{pmNoOfMSUTransmitted})-({pmNoOfNacks}+{pmNoOfSuReceivedInError})),({pmNoOfMSUReceived}+{pmNoOfMSUTransmitted})) | FLOAT | % | The SS7 narrowband quality over TDM | ermgwmsbh |
| Avg_MSU_Rcvd_Rate | ericsson_signalling_point_mtp2_terminating_point_2_raw.avg_msu_rcvd_rate | FLOAT | MSU/sec | Received MSUs per second | ermgwmsbh |
| Avg_MSU_Sent_Rate | ericsson_signalling_point_mtp2_terminating_point_2_raw.avg_msu_sent_rate | FLOAT | MSU/sec | Sent MSUs per second | ermgwmsbh |
| MTP2_Link_Rcvd_Rate | ericsson_signalling_point_mtp2_terminating_point_2_raw.mtp2_link_rcvd_rate | FLOAT | Kbit/s | Received Kbit/s on an MTP2 link | ermgwmsbh |
| MTP2_Link_Sent_Rate | ericsson_signalling_point_mtp2_terminating_point_2_raw.mtp2_link_sent_rate | FLOAT | Kbit/s | Transmitted Kbit/s on an MTP link | ermgwmsbh |
| pmLocalSIBTime | ericsson_signalling_point_mtp2_terminating_point_raw.pmlocalsibtime | INT8 | # | Total time of Status Indication Busy (SIB) in the local node. | ermgwmsbh |
| pmNoOfMSUReceived | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofmsureceived | INT8 | # | Total number of MSUs received. | ermgwmsbh |
| pmNoOfMSUTransmitted | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofmsutransmitted | INT8 | # | Total number of MSUs transmitted. | ermgwmsbh |
| pmNoOfNacks | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofnacks | INT8 | # | Total number of negative acknowledgements received. | ermgwmsbh |
| pmNoOfReTransmittedOctets | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofretransmittedoctets | INT8 | # | Total number of re-transmitted octets. | ermgwmsbh |
| pmNoOfSendBufferOctets | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofsendbufferoctets | INT8 | # | Total number of octets in send buffer. | ermgwmsbh |
| pmNoOfSIOSIFReceived | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofsiosifreceived | INT8 | # | Total number of Service Information Octet (SIO) and Signal Information Field (SIF) octets received. | ermgwmsbh |
| pmNoOfSIOSIFTransmitted | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofsiosiftransmitted | INT8 | # | Total number of SIO and SIF octets transmitted. | ermgwmsbh |
| pmNoOfStartedRBCongestion | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofstartedrbcongestion | INT8 | # | Total number of started local RB congestions. | ermgwmsbh |
| pmNoOfSuReceivedInError | ericsson_signalling_point_mtp2_terminating_point_raw.pmnoofsureceivedinerror | INT8 | # | Total number of signal units received in error. | ermgwmsbh |
| pmRemoteSIBTime | ericsson_signalling_point_mtp2_terminating_point_raw.pmremotesibtime | INT8 | # | Total time of SIB in a remote node. | ermgwmsbh |
| ratio_TX_to_RX_MSU | ericsson_signalling_point_mtp2_terminating_point_2_raw.ratio_tx_to_rx_msu | FLOAT | # | Ratio of MSU transmitted to that received | ermgwmsbh |
MTP3b signalling point data -2
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfDiscardedMsgFromBroadToNarrow}) | FLOAT | % | ||
| pmNoOfDiscardedMsgFromBroadToNarrow | ericsson_signalling_point_mtp3b_signalling_point2_raw.pmnoofdiscardedmsgfrombroadtonarrow | INT8 | # | Total number of messages discarded from broadband to narrowband. | ermgwmsbh |
| pmNoOfSecsAccRouteSetUnavailable | ericsson_signalling_point_mtp3b_signalling_point2_raw.pmnoofsecsaccroutesetunavailable | INTEGER | Seconds | Number of seconds of route set unavailability accumulated during 30 minutes | ermgwmsbh |
| pmNoOfTransferAllowedRec | ericsson_signalling_point_mtp3b_signalling_point2_raw.pmnooftransferallowedrec | INTEGER | # | Number of received Transfer Allowed (TFA) messages. | ermgwmsbh |
| pmNoOfTransferControlledRec | ericsson_signalling_point_mtp3b_signalling_point2_raw.pmnooftransfercontrolledrec | INTEGER | # | Number of received Transfer Control (TFC) messages. | ermgwmsbh |
| pmNoOfTransferProhibitedRec | ericsson_signalling_point_mtp3b_signalling_point2_raw.pmnooftransferprohibitedrec | INTEGER | # | Number of received Transfer Prohibited (TFP) messages. | ermgwmsbh |
MTP3b signalling point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfCBARec}) | FLOAT | % | ||
| %_pmNoOfForcedRerouteSuccessPerf | percentok({pmNoOfControlledRerouteSuccessPerf},({pmNoOfControlledRerouteSuccessPerf}+{pmNoOfUnsuccessControlledRerouting})) | FLOAT | % | Obsolete in R4.1:Controlled rerouting success rate | ermgwmsbh |
| %_pmNoOfUnsuccessForcedRerouting | percentok({pmNoOfForcedRerouteSuccessPerf},({pmNoOfForcedRerouteSuccessPerf}+{pmNoOfUnsuccessForcedRerouting})) | FLOAT | % | Forced rerouting success rate | ermgwmsbh |
| pmNoOfCBARec | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofcbarec | INT8 | # | Total number of received Changeback Acknowledge (CBA) messages. | ermgwmsbh |
| pmNoOfCBASent | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofcbasent | INT8 | # | Total number of sent CBA messages. | ermgwmsbh |
| pmNoOfChangeBackDeclRec | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofchangebackdeclrec | INT8 | # | Total number of received Change Back Declaration (CBD) messages. | ermgwmsbh |
| pmNoOfChangeOverRec | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofchangeoverrec | INT8 | # | Total number of received Changeover Order (COO) messages. | ermgwmsbh |
| pmNoOfCOAXCARec | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofcoaxcarec | INT8 | # | Total number of received COA/XCA messages. | ermgwmsbh |
| pmNoOfCOAXCASent | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofcoaxcasent | INT8 | # | Total number of sent Changeover Acknowledge (COA)/Extended Changeover Acknowledge (XCA) messages. | ermgwmsbh |
| pmNoOfControlledRerouteSuccessPerf | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofcontrolledreroutesuccessperf | INT8 | # | Total number of successfully performed controlled reroutings. | ermgwmsbh |
| pmNoOfECARec | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofecarec | INT8 | # | Total number of received ECA messages. | ermgwmsbh |
| pmNoOfECASent | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofecasent | INT8 | # | Total number of sent Emergency Changeover Acknowledge (ECA) messages. | ermgwmsbh |
| pmNoOfECOSent | ericsson_signalling_point_mtp3b_signalling_point_1_raw.pmnoofecosent | INT8 | # | Total number of sent ECO messages. | ermgwmsbh |
| pmNoOfEmergencyChangeOverRec | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnoofemergencychangeoverrec | INT8 | # | Total number of received Emergency Changeover Order (ECO) messages. | ermgwmsbh |
| pmNoOfForcedRerouteSuccessPerf | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnoofforcedreroutesuccessperf | INT8 | # | Total number of successfully performed forced reroutings. | ermgwmsbh |
| pmNoOfIncAssocEstReqInStateDwnStateEstBlocked | ericsson_signalling_point_mtp3b_signalling_point_3_raw.pmnoofincassocestreqinstatedwnstateestblocked | INTEGER | # | pmNoOfIncomingAssocEstabRequestInStateDownWhenStateEstabIsBlocked:The number of incoming requests for association establishment when the state on the association is DOWN and establishment of associations is blocked. | ermgwmsbh |
| pmNoOfLowerPrioMsgDiscarded | ericsson_signalling_point_mtp3b_signalling_point_3_raw.pmnooflowerpriomsgdiscarded | INTEGER | # | The number of messages with low priority that been discarded. | ermgwmsbh |
| pmNoOfMaxTrialsForAssocActivReached | ericsson_signalling_point_mtp3b_signalling_point_3_raw.pmnoofmaxtrialsforassocactivreached | INTEGER | # | The number of times that the max limit for trying to activate an association has been reached. | ermgwmsbh |
| pmNoOfMaxTrialsForAssocEstabReached | ericsson_signalling_point_mtp3b_signalling_point_3_raw.pmnoofmaxtrialsforassocestabreached | INTEGER | # | The number of times that the max limit for trying to establish an association has been reached. | ermgwmsbh |
| pmNoOfSLTAFirstTimeOutRec | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnoofsltafirsttimeoutrec | INT8 | # | Total number of received Signalling Link Test Acknowledge (SLTA) messages for first time out check. | ermgwmsbh |
| pmNoOfSLTASecondTimeOutRec | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnoofsltasecondtimeoutrec | INT8 | # | Total number of received Signalling Link Test Acknowledge (SLTA) messages for second time out check. | ermgwmsbh |
| pmNoOfSuccessAssocAbort | ericsson_signalling_point_mtp3b_signalling_point_3_raw.pmnoofsuccessassocabort | INTEGER | # | The number of successful abortions of signalling associations. | ermgwmsbh |
| pmNoOfSuccessAssocShutDown | ericsson_signalling_point_mtp3b_signalling_point_3_raw.pmnoofsuccessassocshutdown | INTEGER | # | The number of successful shutdowns of signalling associations. | ermgwmsbh |
| pmNoOfTimerT21WasStarted | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnooftimert21wasstarted | INT8 | # | Total number of times the timer T21 was started. | ermgwmsbh |
| pmNoOfTRARec | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnooftrarec | INT8 | # | Total number of received Traffic Restart Allowed (TRA) messages. | ermgwmsbh |
| pmNoOfTRASent | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnooftrasent | INT8 | # | Total number of sent TRA messages. | ermgwmsbh |
| pmNoOfUnsuccessAssocShutDown | ericsson_signalling_point_mtp3b_signalling_point_3_raw.pmnoofunsuccessassocshutdown | INTEGER | # | The number of unsuccessful shutdowns of signalling associations. | ermgwmsbh |
| pmNoOfUnsuccessControlledRerouting | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnoofunsuccesscontrolledrerouting | INT8 | # | Obsolete in R4.1:Total number of unsuccessfully performed controlled reroutings. | ermgwmsbh |
| pmNoOfUnsuccessForcedRerouting | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnoofunsuccessforcedrerouting | INT8 | # | Total number of unsuccessfully performed forced reroutings. | ermgwmsbh |
| pmNoOfUPMsgDiscardedDueToRoutingErr | ericsson_signalling_point_mtp3b_signalling_point_2_raw.pmnoofupmsgdiscardedduetoroutingerr | INT8 | # | Total number of user part messages (MTP_Transfer_Req) discarded due to routing error. | ermgwmsbh |
SCCP accounting data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfMsg}) | FLOAT | % | ||
| pmNoOfMsg | ericsson_signalling_point_sccp_acc_and_pol_raw.pmnoofmsg | INT8 | # | Total number of messages, both incoming and outgoing. | ermgwmsbh |
| pmNoOfOctets | ericsson_signalling_point_sccp_acc_and_pol_raw.pmnoofoctets | INT8 | Octets | Total number of octets, both incoming and outgoing. | ermgwmsbh |
SCCP policing data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfRejectMsg}) | FLOAT | % | ||
| pmNoOfRejectMsg | ericsson_signalling_point_sccp_acc_and_pol2_raw.pmnoofrejectmsg | INT8 | # | Total number of rejected messages. | ermgwmsbh |
SCCP relay signalling point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfCREFRecFromNL}) | FLOAT | % | ||
| pmNoOfConInUseExceedHighWaterMark | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofconinuseexceedhighwatermark | INT8 | # | Total number of connections in use that has exceeded the high watermark threshold. | ermgwmsbh |
| pmNoOfConInUseReceededLowWaterMark | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofconinusereceededlowwatermark | INT8 | # | Total number of connections in use that has receded the low watermark threshold. | ermgwmsbh |
| pmNoOfCREFRecFromNL | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofcrefrecfromnl | INT8 | # | Total number of received Connection Refused (CREF) messages from network layer. | ermgwmsbh |
| pmNoOfCREFSentToNL | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofcrefsenttonl | INT8 | # | Total number of CREF messages sent to the network layer. | ermgwmsbh |
| pmNoOfCrRec | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofcrrec | INT8 | # | Total number of received Connection Request (CR) messages. | ermgwmsbh |
| pmNoOfCrSent | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofcrsent | INT8 | # | Total number of sent CR messages. | ermgwmsbh |
| pmNoOfDT1Rec | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofdt1rec | INT8 | # | Total number of received Data Form 1 (DT1) messages. | ermgwmsbh |
| pmNoOfDT1Sent | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofdt1sent | INT8 | # | Total number of sent DT1 messages. | ermgwmsbh |
| pmNoOfERRRec | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnooferrrec | INT8 | # | Total number of received Protocol Data Unit Error (ERR) messages. | ermgwmsbh |
| pmNoOfERRSent | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnooferrsent | INT8 | # | Total number of sent ERR messages. | ermgwmsbh |
| pmNoOfLUDTRec | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofludtrec | INT8 | # | Total number of received Long Unitdata (LUDT) messages. | ermgwmsbh |
| pmNoOfLUDTSSent | ericsson_signalling_point_sccp_relay_sig_pt_1_raw.pmnoofludtssent | INT8 | # | Total number of sent Long Unitdata Service (LUDTS) messages. | ermgwmsbh |
| pmNoOfRLSDRecFromNL | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofrlsdrecfromnl | INT8 | # | Total number of received Released (RLSD) messages from the network layer. | ermgwmsbh |
| pmNoOfRLSDSentToNL | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofrlsdsenttonl | INT8 | # | Total number of sent RLSD messages sent to the network layer. | ermgwmsbh |
| pmNoOfSubsysAllowedSent | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofsubsysallowedsent | INT8 | # | Total number of sent SubsysAllowed messages. | ermgwmsbh |
| pmNoOfUDTRec | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofudtrec | INT8 | # | Total number of received Unit Data (UDT) messages.. | ermgwmsbh |
| pmNoOfUDTSent | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofudtsent | INT8 | # | Total number of sent UDT messages. | ermgwmsbh |
| pmNoOfUDTSRec | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofudtsrec | INT8 | # | Total number of received Unit Data Service (UDTS) messages. | ermgwmsbh |
| pmNoOfUDTSSent | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofudtssent | INT8 | # | Total number of sent UDTS messages. | ermgwmsbh |
| pmNoOfXUDTRec | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofxudtrec | INT8 | # | Total number of received Extended Unit Data (XUDT) messages. | ermgwmsbh |
| pmNoOfXUDTSent | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofxudtsent | INT8 | # | Total number of sent XUDT messages. | ermgwmsbh |
| pmNoOfXUDTSRec | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofxudtsrec | INT8 | # | Total number of received Extended Unit Data Service (XUDTS) messages. | ermgwmsbh |
| pmNoOfXUDTSSent | ericsson_signalling_point_sccp_relay_sig_pt_2_raw.pmnoofxudtssent | INT8 | # | Total number of sent XUDTS messages. | ermgwmsbh |
| Tot_pmNoOfERRRec | ericsson_signalling_point_sccp_relay_sig_pt_3_raw.tot_pmnooferrrec | FLOAT | msg/sec | The total number of SCCP Protocol Data Unit Error (ERR) messages received per second | ermgwmsbh |
| Tot_pmNoOfERRSent | ericsson_signalling_point_sccp_relay_sig_pt_3_raw.tot_pmnooferrsent | FLOAT | msg/sec | The total number of SCCP Protocol Data Unit Error (ERR) messages sent per second | ermgwmsbh |
| Tot_SCCP_Msg_Rcvd | ericsson_signalling_point_sccp_relay_sig_pt_3_raw.tot_sccp_msg_rcvd | FLOAT | msg/sec | The total number of connectionless SCCP messages received per second | ermgwmsbh |
| Tot_SCCP_Msg_Sent | ericsson_signalling_point_sccp_relay_sig_pt_3_raw.tot_sccp_msg_sent | FLOAT | msg/sec | The total number of connectionless SCCP messages sent per second | ermgwmsbh |
SCCP routing CRC data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfConnectFailure}) | FLOAT | % | ||
| pmNoOfConnectFailure | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofconnectfailure | INT8 | # | Total number of connect failures. | ermgwmsbh |
| pmNoOfHopCounterViolation | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofhopcounterviolation | INT8 | # | Total number of Hop counter violations. | ermgwmsbh |
| pmNoOfRoutingFailNetworkCongest | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofroutingfailnetworkcongest | INT8 | # | Total number of routing failures due to network congestion. | ermgwmsbh |
| pmNoOfRoutingFailNoTransAddOfSuchNature | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofroutingfailnotransaddofsuchnature | INT8 | # | Total number of routing failures due to no translation for Nature of Address field. | ermgwmsbh |
| pmNoOfRoutingFailNoTransSpecificAddr | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofroutingfailnotransspecificaddr | INT8 | # | Total number of routing failures due to no translation of specific address. | ermgwmsbh |
| pmNoOfRoutingFailReasonUnknown | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofroutingfailreasonunknown | INT8 | # | Total number of routing failures due to unknown reason. | ermgwmsbh |
| pmNoOfRoutingFailSubsysUnavail | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofroutingfailsubsysunavail | INT8 | # | Total number of routing failures due to destination subsystem unavailable. | ermgwmsbh |
| pmNoOfRoutingFailUnequippedSubsys | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofroutingfailunequippedsubsys | INT8 | # | Total number of routing failures due to unequipped subsystem. | ermgwmsbh |
| pmNoOfRoutingFailurePointCodeUnAvail | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofroutingfailurepointcodeunavail | INT8 | # | Total number of routing failures due to destination point code not available. | ermgwmsbh |
| pmNoOfRoutingFailure | ericsson_signalling_point_sccp_routing_crc_raw.pmnoofroutingfailure | INT8 | # | Total number of routing failures. | ermgwmsbh |
Utilisation data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfAALINServiceInd}) | FLOAT | % | ||
| Avg_MSU_Rcvd_Rate | ericsson_signalling_point_utilisation_2_raw.avg_msu_rcvd_rate | FLOAT | MSU/sec | Received MSUs per second | ermgwmsbh |
| Avg_MSU_Sent_Rate | ericsson_signalling_point_utilisation_2_raw.avg_msu_sent_rate | FLOAT | MSU/sec | Transmitted MSUs per second | ermgwmsbh |
| pmNoOfAALINServiceInd | ericsson_signalling_point_utilisation_raw.pmnoofaalinserviceind | INT8 | # | Number of received link in-service indications. | ermgwmsbh |
| pmNoOfAALOUTInd | ericsson_signalling_point_utilisation_raw.pmnoofaaloutind | INT8 | # | Number of received link out-of-service indications. | ermgwmsbh |
| pmNoOfCBDSent | ericsson_signalling_point_utilisation_raw.pmnoofcbdsent | INT8 | # | Number of sent Change Back Declaration (CBD) messages. | ermgwmsbh |
| pmNoOfCOOXCOSent | ericsson_signalling_point_utilisation_raw.pmnoofcooxcosent | INT8 | # | Number of sent Change Over Order (COO) or extended Change Over Order (XCO) messages. | ermgwmsbh |
| pmNoOfLocalLinkCongestCeaseRec | ericsson_signalling_point_utilisation_raw.pmnooflocallinkcongestceaserec | INT8 | # | Number of local link congestion ceased primitives received. | ermgwmsbh |
| pmNoOfLocalLinkCongestRec | ericsson_signalling_point_utilisation_raw.pmnooflocallinkcongestrec | INT8 | # | Number of local link congestion primitives received. | ermgwmsbh |
| pmNoOfMSURec | ericsson_signalling_point_utilisation_raw.pmnoofmsurec | INT8 | # | Number of received Message Signal Units (MSUs) on this signalling link. | ermgwmsbh |
| pmNoOfMSUSent | ericsson_signalling_point_utilisation_raw.pmnoofmsusent | INT8 | # | Number of sent MSUs from this signalling link. | ermgwmsbh |
Stream control transmission protocol IP data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmIcmpInDestUnreachs}) | FLOAT | % | ||
| %_Rcvd_Datagram_Discard | percentfail({pmIpInDiscards},{pmIpInReceives}) | FLOAT | % | The ratio of discarded, received IP datagrams | ermgwmsbh |
| %_Rvcd_IP_Packet_Err | percentfail(({pmIpInAddrErrors}+{pmIpInHdrErrors}+{pmIpInUnknownProtos}),{pmIpInReceives}) | FLOAT | % | The ratio of errored, received IP packets | ermgwmsbh |
| %_Sent_Datagram_Discard | percentfail({pmIpOutDiscards},{pmIpOutRequests}) | FLOAT | % | The ratio of discarded, sent IP datagrams | ermgwmsbh |
| pmIcmpInDestUnreachs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpindestunreachs | INT8 | # | Total number of ICMP Destination Unreachable messages received. | ermgwmsbh |
| pmIcmpInEchoReps | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpinechoreps | INT8 | # | Total number of ICMP Echo Reply messages received. | ermgwmsbh |
| pmIcmpInEchos | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpinechos | INT8 | # | Total number of ICMP Echo (request) messages received. | ermgwmsbh |
| pmIcmpInErrors | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpinerrors | INT8 | # | Total number of ICMP messages which the entity received but determined as having ICMP-specific errors. | ermgwmsbh |
| pmIcmpInMsgs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpinmsgs | INT8 | # | Total number of ICMP messages which the entity received. | ermgwmsbh |
| pmIcmpInParamProbs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpinparamprobs | INT8 | # | Total number of ICMP Parameter Problem messages received. | ermgwmsbh |
| pmIcmpInRedirects | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpinredirects | INT8 | # | Total number of ICMP Redirect messages received. | ermgwmsbh |
| pmIcmpInSrcQuenchs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpinsrcquenchs | INT8 | # | Total number of ICMP Source Quench messages received. | ermgwmsbh |
| pmIcmpInTimeExcds | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpintimeexcds | INT8 | # | Total number of ICMP Time Exceeded messages received. | ermgwmsbh |
| pmIcmpOutDestUnreachs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpoutdestunreachs | INT8 | # | Total number of ICMP Destination Unreachable messages sent. | ermgwmsbh |
| pmIcmpOutEchoReps | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpoutechoreps | INT8 | # | Total number of ICMP Echo Reply messages sent. | ermgwmsbh |
| pmIcmpOutEchos | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpoutechos | INT8 | # | Total number of ICMP Echo (request) messages sent. | ermgwmsbh |
| pmIcmpOutErrors | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpouterrors | INT8 | # | Total number of ICMP messages which this entity did not send due to problems discovered within ICMP such as a lack of buffers. | ermgwmsbh |
| pmIcmpOutMsgs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpoutmsgs | INT8 | # | Total number of ICMP messages which this entity attempted to send. | ermgwmsbh |
| pmIcmpOutParamProbs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmicmpoutparamprobs | INT8 | # | Total number of ICMP Parameter Problem messages sent. | ermgwmsbh |
| pmIpFragCreates | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmipfragcreates | INT8 | # | Total number of IP datagram fragments that have been generated as a result of fragmentation at this entity. | ermgwmsbh |
| pmIpFragFails | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmipfragfails | INT8 | # | Total number of IP datagrams that have been discarded because they needed to be fragmented at this entity but could not be. | ermgwmsbh |
| pmIpFragOKs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmipfragoks | INT8 | # | Total number of IP datagrams that have been successfully fragmented at this entity. | ermgwmsbh |
| pmIpInAddrErrors | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_1_raw.pmipinaddrerrors | INT8 | # | Total number of input datagrams discarded because the IP address in their IP headers destination field was not a valid address to be received at this entity. | ermgwmsbh |
| pmIpInDelivers | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipindelivers | INT8 | # | Total number of input datagrams successfully delivered to IP user-protocols (including ICMP). | ermgwmsbh |
| pmIpInDiscards | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipindiscards | INT8 | # | Total number of input IP datagrams for which no problems were encountered to prevent their continued processing, but which were discarded. | ermgwmsbh |
| pmIpInHdrErrors | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipinhdrerrors | INT8 | # | Total number of input datagrams discarded due to errors in their IP headers. | ermgwmsbh |
| pmIpInReceives | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipinreceives | INT8 | # | Total number of input datagrams received from interfaces. | ermgwmsbh |
| pmIpInUnknownProtos | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipinunknownprotos | INT8 | # | Total number of locally-addressed datagrams received successfully but discarded because of an unknown or unsupported protocol. | ermgwmsbh |
| pmIpOutDiscards | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipoutdiscards | INT8 | # | Total number of output IP datagrams for which no problem was encountered to prevent their transmission to their destination, but which were discarded (for example, for lack of buffer space). | ermgwmsbh |
| pmIpOutRequests | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipoutrequests | INT8 | # | Total number of IP datagrams which local IP userprotocols (including ICMP) supplied to IP in requests for transmission. | ermgwmsbh |
| pmIpReasmFails | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipreasmfails | INT8 | # | Total number of failures detected by the IP re-assembly algorithm (for whatever reason: timed out, errors, etc). | ermgwmsbh |
| pmIpReasmOKs | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipreasmoks | INT8 | # | Total number of IP datagrams successfully re-assembled. | ermgwmsbh |
| pmIpReasmReqds | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmipreasmreqds | INT8 | # | Total number of IP fragments received which needed to be reassembled at this entity. | ermgwmsbh |
| pmNoOfIfInBroadcastPkts | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmnoofifinbroadcastpkts | INT8 | # | Obsolete in R4.1:Total number of input broadcast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfInDiscards | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmnoofifindiscards | INT8 | # | Obsolete in R4.1:Total number of input packets discarded due to resource limitations. | ermgwmsbh |
| pmNoOfIfInErrors | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmnoofifinerrors | INT8 | # | Obsolete in R4.1:Total number of input packets discarded due to any error. | ermgwmsbh |
| pmNoOfIfInMulticastPkts | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmnoofifinmulticastpkts | INT8 | # | Obsolete in R4.1:Total number of input broadcast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfInUcastPkts | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmnoofifinucastpkts | INT8 | # | Obsolete in R4.1:Total number of input unicast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfOutBroadcastPkts | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmnoofifoutbroadcastpkts | INT8 | # | Obsolete in R4.1:Total number of output broadcast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfOutMulticastPkts | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmnoofifoutmulticastpkts | INT8 | # | Obsolete in R4.1:Total number of output broadcast packets delivered to higher layer. | ermgwmsbh |
| pmNoOfIfOutUcastPkts | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_2_raw.pmnoofifoutucastpkts | INT8 | # | Obsolete in R4.1:Total number of output unicast packets delivered to higher layer. | ermgwmsbh |
| pmUdpInDatagrams | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_3_raw.pmudpindatagrams | INTEGER | # | The total number of User Datagram Protocol (UDP) datagrams delivered to UDP users. | ermgwmsbh |
| pmUdpInErrors | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_3_raw.pmudpinerrors | INTEGER | # | The number of received User Datagram Protocol (UDP) datagrams that could not be delivered for reasons other than the lack of an application at the destination port. | ermgwmsbh |
| pmUdpNoPorts | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_3_raw.pmudpnoports | INTEGER | # | The total number of received User Datagram Protocol (UDP) datagrams, for which there was no application at the destination port. | ermgwmsbh |
| pmUdpOutDatagrams | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_3_raw.pmudpoutdatagrams | INTEGER | # | The total number of User Datagram Protocol (UDP) datagrams sent from this entity. | ermgwmsbh |
| Tot_Sent_IP_Datagram | ericsson_sigtran_strm_ctrl_trans_prtcl_ip_3_raw.tot_sent_ip_datagram | INTEGER | # | The total number of sent IP datagrams | ermgwmsbh |
Stream control transmission protocol M3UA data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfAspacAckReceived}) | FLOAT | % | ||
| Avg_Payload_Msg_Rvcd | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_3_raw.avg_payload_msg_rvcd | FLOAT | msg/sec | The number of payload data messages received per second | ermgwmsbh |
| Avg_Payload_Msg_Sent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_3_raw.avg_payload_msg_sent | FLOAT | msg/sec | The number of payload data messages sent per second | ermgwmsbh |
| pmNoOfAspacAckReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspacackreceived | INT8 | # | Total number of Application Server Process Active (ASPAC) ACK messages received through the association. | ermgwmsbh |
| pmNoOfAspacAckSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspacacksent | INT8 | # | Total number of ASPAC ACK messages sent through the association. | ermgwmsbh |
| pmNoOfAspacReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspacreceived | INT8 | # | Total number of ASPAC messages received through the association. | ermgwmsbh |
| pmNoOfAspacSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspacsent | INT8 | # | Total number of ASPAC messages sent through the association. | ermgwmsbh |
| pmNoOfAspdnAckReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspdnackreceived | INT8 | # | Total number of Application Server Process Down (ASPDN) ACK messages received through the association. | ermgwmsbh |
| pmNoOfAspdnAckSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspdnacksent | INT8 | # | Total number of ASPDN ACK messages sent through the association. | ermgwmsbh |
| pmNoOfAspdnReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspdnreceived | INT8 | # | Total number of ASPDN messages received through the association. | ermgwmsbh |
| pmNoOfAspdnSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspdnsent | INT8 | # | Total number of ASPDN messages sent through the association. | ermgwmsbh |
| pmNoOfAspiaAckReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspiaackreceived | INT8 | # | Total number of Application Server Process Inactive (ASPIA) ACK messages received through the association. | ermgwmsbh |
| pmNoOfAspiaAckSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspiaacksent | INT8 | # | Total number of ASPIA ACK messages sent through the association. | ermgwmsbh |
| pmNoOfAspiaReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspiareceived | INT8 | # | Total number of ASPIA messages received through the association. | ermgwmsbh |
| pmNoOfAspiaSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspiasent | INT8 | # | Total number of ASPIA messages sent through the association. | ermgwmsbh |
| pmNoOfAspupAckReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspupackreceived | INT8 | # | Total number of Application Server Process Up (ASPUP) ACK messages received through the association. | ermgwmsbh |
| pmNoOfAspupAckSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspupacksent | INT8 | # | Total number of ASPUP ACK messages sent through the association. | ermgwmsbh |
| pmNoOfAspupReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspupreceived | INT8 | # | Total number of ASPUP messages received through the association. | ermgwmsbh |
| pmNoOfAspupSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofaspupsent | INT8 | # | Total number of ASPUP messages sent through the association. | ermgwmsbh |
| pmNoOfCommunicationLost | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_1_raw.pmnoofcommunicationlost | INT8 | # | Total number of communication losses. | ermgwmsbh |
| pmNoOfCongestions | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofcongestions | INT8 | # | Total number of congestions. | ermgwmsbh |
| pmNoOfDataMsgRec | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdatamsgrec | INT8 | # | Total number of DATA (payload data) messages received through the association. | ermgwmsbh |
| pmNoOfDataMsgSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdatamsgsent | INT8 | # | Number of DATA messages sent on the associations related to this signalling point. | ermgwmsbh |
| pmNoOfDaudMsgSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdaudmsgsent | INT8 | # | Total number of Destination State Audit (DAUD)messages sent on the associations related to this signalling point. | ermgwmsbh |
| pmNoOfDaudReceived | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdaudreceived | INT8 | # | Total number of DAUD messages received through the association. | ermgwmsbh |
| pmNoOfDavaRec | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdavarec | INT8 | # | Total number of Destination Available (DAVA) messages received through the association. | ermgwmsbh |
| pmNoOfDavaSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdavasent | INT8 | # | Total number of DAVA messages sent through the association. | ermgwmsbh |
| pmNoOfDunaRec | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdunarec | INT8 | # | Total number of Destination Unavailable (DUNA) messages received through the association. | ermgwmsbh |
| pmNoOfDunaSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdunasent | INT8 | # | Total number of DUNA messages sent through the association. | ermgwmsbh |
| pmNoOfDupuRec | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdupurec | INT8 | # | Total number of Destination User Part Unavailable (DUPU) messages received through the association. | ermgwmsbh |
| pmNoOfDupuSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofdupusent | INT8 | # | Total number of DUPU messages sent through the association. | ermgwmsbh |
| pmNoOfErrorMsgRec | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnooferrormsgrec | INT8 | # | Number of ERROR messages received through the association. | ermgwmsbh |
| pmNoOfErrorMsgSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnooferrormsgsent | INT8 | # | Total number of ERROR messages sent through the association. | ermgwmsbh |
| pmNoOfM3uaDataMsgDiscarded | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofm3uadatamsgdiscarded | INT8 | # | Total number of discarded M3UA data messages. | ermgwmsbh |
| pmNoOfNotifyMsgRec | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofnotifymsgrec | INT8 | # | Number of NOTIFY messages received through the association. | ermgwmsbh |
| pmNoOfSconRec | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofsconrec | INT8 | # | Total number of Signalling Congestion (SCON) messages received through the association. | ermgwmsbh |
| pmNoOfSconSent | ericsson_sigtran_strm_ctrl_trans_prtcl_m3ua_2_raw.pmnoofsconsent | INT8 | # | Total number of SCON messages sent through the association. | ermgwmsbh |
Stream control transmission protocol MTP3 data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfSctpAssociationRestart}) | FLOAT | % | ||
| pmNoOfSctpAssociationRestart | ericsson_sigtran_stream_ctrl_trans_prtcl_mtp3_raw.pmnoofsctpassociationrestart | INT8 | # | Total number of SCTP association restarts. | ermgwmsbh |
| pmNoOfSctpBufOverflow | ericsson_sigtran_stream_ctrl_trans_prtcl_mtp3_raw.pmnoofsctpbufoverflow | INT8 | # | Total number of SCTP stop sending data. | ermgwmsbh |
| pmNoOfSctpCommunicationErr | ericsson_sigtran_stream_ctrl_trans_prtcl_mtp3_raw.pmnoofsctpcommunicationerr | INT8 | # | Total number of SCTP communication error. | ermgwmsbh |
| pmNoOfSctpNetworkStatusChange | ericsson_sigtran_stream_ctrl_trans_prtcl_mtp3_raw.pmnoofsctpnetworkstatuschange | INT8 | # | Total number of SCTP network status changes. | ermgwmsbh |
| pmNoOfSctpResumeSending | ericsson_sigtran_stream_ctrl_trans_prtcl_mtp3_raw.pmnoofsctpresumesending | INT8 | # | Total number of SCTP resume sending data. | ermgwmsbh |
| pmNoOfSctpSendFailure | ericsson_sigtran_stream_ctrl_trans_prtcl_mtp3_raw.pmnoofsctpsendfailure | INT8 | # | Total number of SCTP send failure. | ermgwmsbh |
| pmNoOfSuccessAssocEstablish | ericsson_sigtran_stream_ctrl_trans_prtcl_mtp3_raw.pmnoofsuccessassocestablish | INT8 | # | Total number of successful association establishments. | ermgwmsbh |
| pmNoOfUnsuccessAssocEstablish | ericsson_sigtran_stream_ctrl_trans_prtcl_mtp3_raw.pmnoofunsuccessassocestablish | INT8 | # | Total number of unsuccessful association establishments. | ermgwmsbh |
Stream control transmission protocol data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmSctpAborted}) | FLOAT | % | ||
| pmSctpAborted | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpaborted | INT8 | # | Total number of times that SCTP associations have made a direct transition to the CLOSED state from any state using the primitive ABORT. | ermgwmsbh |
| pmSctpActiveEstab | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpactiveestab | INT8 | # | Total number of times that SCTP associations have made a direct transition to the ESTABLISHED state from the COOKIE-ECHOED state. | ermgwmsbh |
| pmSctpCurrEstab | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpcurrestab | INT8 | # | Current number of SCTP associations for which the current state is either ESTABLISHED, SHUTDOWN-PENDING, or SHUTDOWN-RECEIVED. | ermgwmsbh |
| pmSctpPassiveEstab | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctppassiveestab | INT8 | # | Total number of times that SCTP associations have made a direct transition to the ESTABLISHED state from the CLOSED state. | ermgwmsbh |
| pmSctpShutdowns | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpshutdowns | INT8 | # | The total number of times that SCTP associations have made a direct transition to the CLOSED state from either the SHUTDOWN-SENT state or the SHUTDOWN-ACK-SENT state. | ermgwmsbh |
| pmSctpStatAssocOutOfBlue | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpstatassocoutofblue | INT8 | # | Total number of out of the blue packets (SCTP packet correctly formed-right checksum- but the receiver is not able to identify the association to which this packet belongs) received by the host. | ermgwmsbh |
| pmSctpStatChecksumErrorCounter | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpstatchecksumerrorcounter | INT8 | # | Total number of SCTP packets received from the peers with an invalid checksum. | ermgwmsbh |
| pmSctpStatCommResume | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpstatcommresume | INT8 | # | Total number of times SCTP has sent a communication resume indication to the user. | ermgwmsbh |
| pmSctpStatCommStop | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpstatcommstop | INT8 | # | Total number of times SCTP has sent a communication stop indication to the user. | ermgwmsbh |
| pmSctpStatFragmentedUserMsg | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpstatfragmentedusermsg | INT8 | # | Total number of fragmented user messages. | ermgwmsbh |
| pmSctpStatOutOfOrderRecChunks | ericsson_sigtran_strm_ctrl_trans_prtcl_1_raw.pmsctpstatoutoforderrecchunks | INT8 | # | Total number of unordered chunks received from the peers. | ermgwmsbh |
| pmSctpStatOutOfOrderSendChunks | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatoutofordersendchunks | INT8 | # | Total number of unordered chunks sent to the peers. | ermgwmsbh |
| pmSctpStatReassembledUserMsg | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatreassembledusermsg | INT8 | # | Total number of reassembled user messages. | ermgwmsbh |
| pmSctpStatRecChunksDropped | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatrecchunksdropped | INT8 | # | Total number of sent chunks that SCTP has been forced to drop due to buffer overflow in the receiving buffer. | ermgwmsbh |
| pmSctpStatRecChunks | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatrecchunks | INT8 | # | Total number of complete data chunks received from the peers (no retransmissions included). | ermgwmsbh |
| pmSctpStatReceivedControlChunks | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatreceivedcontrolchunks | INT8 | # | Total number of datagrams received with chunk type id greater than 0. | ermgwmsbh |
| pmSctpStatReceivedPackages | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatreceivedpackages | INT8 | # | Total number of SCTP packages received. | ermgwmsbh |
| pmSctpStatRetransChunks | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatretranschunks | INT8 | # | Total number of data chunks retransmitted to the peers. | ermgwmsbh |
| pmSctpStatSentChunksDropped | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatsentchunksdropped | INT8 | # | Total number of sent chunks that SCTP has been forced to drop due to buffer overflow in the sending buffer. | ermgwmsbh |
| pmSctpStatSentChunks | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatsentchunks | INT8 | # | Total number of complete data chunks sent to the peers (no retransmissions included). | ermgwmsbh |
| pmSctpStatSentControlChunks | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatsentcontrolchunks | INT8 | # | Total number of datagrams sent with chunk type id greater than 0. | ermgwmsbh |
| pmSctpStatSentPackages | ericsson_sigtran_strm_ctrl_trans_prtcl_2_raw.pmsctpstatsentpackages | INT8 | # | Total number of SCTP packages sent. | ermgwmsbh |
| Tot_SCTP_Data_Chunks_Sent | ericsson_sigtran_strm_ctrl_trans_prtcl_3_raw.tot_sctp_data_chunks_sent | INTEGER | # | The total number of sent SCTP data chunks | ermgwmsbh |
STS1 Terminating point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmEsp}) | FLOAT | % | ||
| pmEsp | ericsson_sts1_sts1_terminating_point_raw.pmesp | INT8 | seconds | Total number of Errored Seconds. | ermgwmsbh |
| pmSesp | ericsson_sts1_sts1_terminating_point_raw.pmsesp | INT8 | seconds | Total number of Severely Errored Seconds. | ermgwmsbh |
| pmUasp | ericsson_sts1_sts1_terminating_point_2_raw.pmuasp | INTEGER | Seconds | Transmission Unavailable Seconds (SES). The accumulated unavailable time in seconds during the interval. Unavailable time starts when 10 consecutive SES are detected (them being part of the unavailable time) and ends when 10 consecutive non-SES are detected. | ermgwmsbh |
STS 3 Terminating point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmEsp}) | FLOAT | % | ||
| pmEsp | ericsson_sts3_sts3_terminating_point_raw.pmesp | INT8 | seconds | Total number of Errored Seconds. | ermgwmsbh |
| pmSesp | ericsson_sts3_sts3_terminating_point_raw.pmsesp | INT8 | seconds | Total number of Severely Errored Seconds. | ermgwmsbh |
| pmUasp | ericsson_sts3_sts3_terminating_point_2_raw.pmuasp | INTEGER | Seconds | Transmission Unavailable Seconds (SES). The accumulated unavailable time in seconds during the interval. Unavailable time starts when 10 consecutive SES are detected (them being part of the unavailable time) and ends when 10 consecutive non-SES are detected. | ermgwmsbh |
T1 terminating point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmEs}) | FLOAT | % | ||
| pmEs | ericsson_t1_t1_terminating_point_raw.pmes | INT8 | seconds | Total number of Errored Seconds. | ermgwmsbh |
| pmSes | ericsson_t1_t1_terminating_point_raw.pmses | INT8 | seconds | Total number of Severely Errored Seconds. | ermgwmsbh |
| pmUas | ericsson_t1_t1_terminating_point_2_raw.pmuas | INTEGER | Seconds | Transmission Unavailable Seconds (SES). The accumulated unavailable time in seconds during the interval. Unavailable time starts when 10 consecutive SES are detected (them being part of the unavailable time) and ends when 10 consecutive non-SES are detected. | ermgwmsbh |
Utilisation data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNrOfTdmTermsBusy}) | FLOAT | % | ||
| %_pmNrOfTdmTermsReq | percentok(({pmNrOfTdmTermsReq}-{pmNrOfTdmTermsRej}),{pmNrOfTdmTermsReq}) | FLOAT | % | Seizure success rate of TDM Terminations in the termination group. | ermgwmsbh |
| %_TDM_Term_Reserve_Succ | percentok(({pmNrOfTDMTermsReq}-{pmNrOfTDMTermsRej}),{pmNrOfTDMTermsReq}) | FLOAT | % | The TDM termination reservation success rate. | ermgwmsbh |
| %_TDM_Utilization | ericsson_tdmtermgrp_utilisation_2_raw.tdm_utilization_pc | FLOAT | % | TDM Group utilization rate | ermgwmsbh |
| pmNrOfTdmTermsBusy | ericsson_tdmtermgrp_utilisation_raw.pmnroftdmtermsbusy | INT8 | # | Current number of TDM Terminations seized in the termination group. | ermgwmsbh |
| pmNrOfTdmTermsRej | ericsson_tdmtermgrp_utilisation_raw.pmnroftdmtermsrej | INT8 | # | Total number of TDM Requests Rejected in TDM Termination Group. | ermgwmsbh |
| pmNrOfTdmTermsReq | ericsson_tdmtermgrp_utilisation_raw.pmnroftdmtermsreq | INT8 | # | Total Number of TDM Seizure Requests in TDM Termination Group. | ermgwmsbh |
VC12 terminating point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmVcEs}) | FLOAT | % | ||
| pmVcBbe | ericsson_vc12_vc12_terminating_point_2_raw.pmvcbbe | INTEGER | Seconds | Transmission Background Block Errors (BBE). Number of errored blocks not being part of a SES. | ermgwmsbh |
| pmVcEs | ericsson_vc12_vc12_terminating_point_raw.pmvces | INT8 | seconds | Total number of Errored Seconds. | ermgwmsbh |
| pmVcSes | ericsson_vc12_vc12_terminating_point_raw.pmvcses | INT8 | seconds | Total number of Severely Errored Seconds. | ermgwmsbh |
| pmVcUas | ericsson_vc12_vc12_terminating_point_2_raw.pmvcuas | INTEGER | Seconds | Transmission Unavailable Seconds (UAS). The accumulated unavailable time in seconds during the interval. Unavailable time starts when 10 consecutive Severely Errored Seconds (SES) are detected (them being part of the unavailable time) and ends when 10 consecutive non SES are detected. | ermgwmsbh |
VC4 terminating point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmVcEs}) | FLOAT | % | ||
| pmVcBbe | ericsson_vc4_vc4_terminating_point_2_raw.pmvcbbe | INTEGER | Seconds | Transmission Background Block Errors (BBE). Number of errored blocks not being part of a SES. | ermgwmsbh |
| pmVcEs | ericsson_vc4_vc4_terminating_point_raw.pmvces | INT8 | seconds | Total number of Errored Seconds. | ermgwmsbh |
| pmVcSes | ericsson_vc4_vc4_terminating_point_raw.pmvcses | INT8 | seconds | Total number of Severely Errored Seconds. | ermgwmsbh |
| pmVcUas | ericsson_vc4_vc4_terminating_point_2_raw.pmvcuas | INTEGER | Seconds | Transmission Unavailable Seconds (UAS). The accumulated unavailable time in seconds during the interval. Unavailable time starts when 10 consecutive Severely Errored Seconds (SES) are detected (them being part of the unavailable time) and ends when 10 consecutive non SES are detected. | ermgwmsbh |
Virtual channel data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({Tx_cells_per_second}) | FLOAT | % | ||
| pmReceivedAtmCells | ericsson_vcltp_virtual_channel_raw.pmreceivedatmcells | INT8 | # | Total number of ATM cells received through this Virtual Channel (VC) link. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmTransmittedAtmCells | ericsson_vcltp_virtual_channel_raw.pmtransmittedatmcells | INT8 | # | Total number of ATM cells transmitted through this VC link. | eraputctbh, ermgwmsbh, ervpltcbh |
| Rx_bandwidth_per_second | ericsson_vcltp_virtual_channel_raw.rx_bandwidth_per_second | FLOAT | # | The amount of received bandwidth per second | eraputctbh, ermgwmsbh, ervpltcbh |
| Rx_cells_per_second | ericsson_vcltp_virtual_channel_raw.rx_cells_per_second | FLOAT | # | Received cells per second | eraputctbh, ermgwmsbh, ervpltcbh |
| Tx_bandwidth_per_second | ericsson_vcltp_virtual_channel_raw.tx_bandwidth_per_second | FLOAT | # | The amount of transmitted bandwidth per second | eraputctbh, ermgwmsbh, ervpltcbh |
| Tx_cells_per_second | ericsson_vcltp_virtual_channel_raw.tx_cells_per_second | FLOAT | # | Transmitted cells per second | eraputctbh, ermgwmsbh, ervpltcbh |
| Usage_rate_Rx | ericsson_vcltp_virtual_channel_raw.usage_rate_rx | FLOAT | # | Usage rate received cells | eraputctbh, ermgwmsbh, ervpltcbh |
| Usage_rate_Tx | ericsson_vcltp_virtual_channel_raw.usage_rate_tx | FLOAT | # | Usage rate transmitted cells | eraputctbh, ermgwmsbh, ervpltcbh |
Bearer Control Tunneling Protocol statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNrOfRecBctpProtocolFailures}) | FLOAT | % | ||
| pmNrOfRecBctpProtocolFailures | ericsson_vmgw_bctp_raw.pmnrofrecbctpprotocolfailures | INTEGER | # | The total number of received BCTP (Q.1990) protocol negotiation failure indications. | ermgwmsbh |
| pmNrOfSentBctpProtocolFailures | ericsson_vmgw_bctp_raw.pmnrofsentbctpprotocolfailures | INTEGER | # | The total number of sent BCTP (Q.1990) protocol negotiation failure indications. | ermgwmsbh |
Bearer Control Protocol statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNrOfOrigIpbcpBearPrepRejected}) | FLOAT | % | ||
| pmNrOfOrigIpbcpBearPrepRejected | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnroforigipbcpbearpreprejected | INTEGER | # | The total number of bearer preparation rejections for originating IP Bearer Control Protocol (IPBCP) connections for example due to lack of resources. | ermgwmsbh |
| pmNrOfOrigIpbcpBearSupervTmrExp | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnroforigipbcpbearsupervtmrexp | INTEGER | # | The total number of bearer supervision timer expirations for originating IP Bearer Control Protocol (IPBCP) connections. The bearer supervision timer (T1) expires if no response for a bearer setup request is received from the remote node within a specified time. | ermgwmsbh |
| pmNrOfRecFaultyIpbcpAcceptMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofrecfaultyipbcpacceptmsg | INTEGER | # | The total number of incorrect or erroneous IP Bearer Control Protocol (IPBCP Q.1970) Accept messages received for originating connections. | ermgwmsbh |
| pmNrOfRecIpbcpAcceptMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofrecipbcpacceptmsg | INTEGER | # | The total number of IP Bearer Control Protocol IPBCP Q.1970) Accepted messages received for originating connections, indicating successful IP setup attempts. | ermgwmsbh |
| pmNrOfRecIpbcpConfusedMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofrecipbcpconfusedmsg | INTEGER | # | The total number of IP Bearer Control Protocol (IPBCP Q.1970) Confused messages received for originating connections. | ermgwmsbh |
| pmNrOfRecIpbcpRejectMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofrecipbcprejectmsg | INTEGER | # | The total number of IP Bearer Control Protocol (IPBCP Q.1970) Reject messages received for originating connections. | ermgwmsbh |
| pmNrOfRecIpbcpRequestMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofrecipbcprequestmsg | INTEGER | # | The total number of IP Bearer Control Protocol (IPBCP Q.1970) Request messages received for terminating connections. | ermgwmsbh |
| pmNrOfSentIpbcpAcceptMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofsentipbcpacceptmsg | INTEGER | # | The total number of IP Bearer Control Protocol (IPBCP Q.1970) Accepted messages sent for terminating connections, indicating successful IP setup attempts. | ermgwmsbh |
| pmNrOfSentIpbcpConfusedMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofsentipbcpconfusedmsg | INTEGER | # | The total number of IP Bearer Control Protocol (IPBCP Q.1970) Confused messages sent for terminating connections. | ermgwmsbh |
| pmNrOfSentIpbcpRejectMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofsentipbcprejectmsg | INTEGER | # | The total number of IP Bearer Control Protocol (IPBCP Q.1970) Reject messages sent for terminating connections. | ermgwmsbh |
| pmNrOfSentIpbcpRequestMsg | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnrofsentipbcprequestmsg | INTEGER | # | The total number of IP Bearer Control Protocol (IPBCP Q.1970) Request messages sent for originating connections. | ermgwmsbh |
| pmNrOfTermIpbcpBearPrepRejected | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnroftermipbcpbearpreprejected | INTEGER | # | The total number of bearer preparation rejections for terminating IP Bearer Control Protocol (IPBCP) connections for example due to lack of resources. | ermgwmsbh |
| pmNrOfTermIpbcpBearSupervTmrExp | ericsson_vmgw_mgw_vmgw_ipbcp_raw.pmnroftermipbcpbearsupervtmrexp | INTEGER | # | The total number of bearer supervision timer expirations for terminating IP Bearer Control Protocol (IPBCP) connections. The bearer supervision timer expires if no bearer setup request is received from the remote node within a specified time. | ermgwmsbh |
Iu interface statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNrOfTermIuInit}) | FLOAT | % | ||
| pmNrOfTermIuInitSucc | ericsson_vmgw_mgw_vmgw_iu_raw.pmnroftermiuinitsucc | INTEGER | # | The total number of successful Iu Initialization procedures initiated by another node, indicated by the sending of a User Plane (UP) Initialization Ack message. | ermgwmsbh |
| pmNrOfTermIuInit | ericsson_vmgw_mgw_vmgw_iu_raw.pmnroftermiuinit | INTEGER | # | The total number of Iu initialization procedures initiated by another node, indicated by the reception of a User Plane (UP) Initialization message. | ermgwmsbh |
Nb interface statistics
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmNoOfAMROnNbConns}) | FLOAT | % | ||
| %_Orig_Nb_Init_Conn_Succ | percentok(({pmNrOfOrigNbInit}-{pmNrOfOrigNbInitFaults}),{pmNrOfOrigNbInit}) | FLOAT | % | The originating Nb connection initialization success rate per VMGW | ermgwmsbh |
| pmNoOfAMROnNbConns | ericsson_vmgw_mgw_vmgw_nb_raw.pmnoofamronnbconns | INTEGER | # | The total number of AMR (Adaptive Multi Rate) coded speech calls over the Nb interface. | ermgwmsbh |
| pmNoOfEFROnNbConns | ericsson_vmgw_mgw_vmgw_nb_raw.pmnoofefronnbconns | INTEGER | # | The total number of Enhanced Full Rate (EFR) coded speech calls over the Nb interface. | ermgwmsbh |
| pmNoOfPCMOnNbConns | ericsson_vmgw_mgw_vmgw_nb_raw.pmnoofpcmonnbconns | INTEGER | # | The total number of Pulse Code Modulation (PCM calls over the Nb interface.) | ermgwmsbh |
| pmNrOfOrigNbInitFaults | ericsson_vmgw_mgw_vmgw_nb_raw.pmnroforignbinitfaults | INTEGER | # | The total number of dropped out (terminated) unsuccessful Nb initialization procedures for Nb connections with initialization sending. | ermgwmsbh |
| pmNrOfOrigNbInit | ericsson_vmgw_mgw_vmgw_nb_raw.pmnroforignbinit | INTEGER | # | The total number of Nb initialization procedures initiated by this node. | ermgwmsbh |
| pmNrOfTermNbInitSucc | ericsson_vmgw_mgw_vmgw_nb_raw.pmnroftermnbinitsucc | INTEGER | # | The total number of successful Nb initialization procedures initiated by another node, indicated by the sending of a User Plane (UP) Initialization Ack message. | ermgwmsbh |
| pmNrOfTermNbInit | ericsson_vmgw_mgw_vmgw_nb_raw.pmnroftermnbinit | INTEGER | # | The total number of Nb initialization procedures initiated by another node, indicated by the reception of a User Plane (UP) Initialization message. | ermgwmsbh |
Utilisation data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_AAL2_Bearer_Est_Succ | percentok((({pmNrOfAal2TermsReq}-{pmNrOfAal2TermsRej})-({pmNrOfIuTermAal2BearEstabFailRem}+{pmNrOfNbOrigAal2BearEstabFailRem}+{pmNrOfNbTermAal2BearEstabFailRem})),({pmNrOfAal2TermsReq}-{pmNrOfAal2TermsRej})) | FLOAT | % | AAL2 bearer establishment success rate | ermgwmsbh |
| %_AAL2_Term_Seize_Succ | percentok(({pmNrOfAal2TermsReq}-{pmNrOfAal2TermsRej}),{pmNrOfAal2TermsReq}) | FLOAT | % | The AAl2 termination seizure success rate per VMGW | ermgwmsbh |
| %_data_coverage | getvalidity({pmGcpNrOfReceivedMessages}) | FLOAT | % | ||
| %_GCP_Message_Sent_Rcvd | percentfail({pmGcpNrOfSentMessages},{pmGcpNrOfReceivedMessages}) | FLOAT | % | The ratio of GCP message statistics (Sent/Received) | ermgwmsbh |
| %_IBPCP_Bearer_Est_Succ | percentok(({pmNrOfIpTermsReq}-{pmNrOfIpTermsRej}-({pmNrOfRecIpbcpRejectMsg}+{pmNrOfSentIpbcpRejectMsg}+{pmNrOfRecIpbcpConfusedMsg}+{pmNrOfRecFaultyIpbcpAcceptMsg}+{pmNrOfOrigIpbcpBearSupervTmrExp}+{pmNrOfTermIpbcpBearSupervTmrExp}+{pmNrOfRecBctpProtocolFailures})),{pmNrOfIpTermsReq}-{pmNrOfIpTermsRej}) | FLOAT | % | IBPCP bearer establishment success rate | ermgwmsbh |
| %_IP_Term_Seize_Succ | percentok(({pmNrOfIpTermsReq}-{pmNrOfIpTermsRej}),{pmNrOfIpTermsReq}) | FLOAT | % | The IP termination seizure success rate per VMGW | ermgwmsbh |
| %_pmGcpNrOfReceivedMessages | percentok({pmGcpNrOfSentMessages},({pmGcpNrOfReceivedMessages}+{pmGcpNrOfSentMessages})) | FLOAT | % | Percentage of sent to received Gateway Control Protocol messages | ermgwmsbh |
| %_pmGcpSystemUpTime | ericsson_vmgw_utilisation_raw.pmgcpsystemuptime_pc | FLOAT | % | Percentage of available system time. | ermgwmsbh |
| %_pmNrOfAal2TermsReq | percentfail({pmNrOfAal2TermsRej},{pmNrOfAal2TermsReq}) | FLOAT | % | Termination success rate for AAL2 requests in this VMGW. | ermgwmsbh |
| %_pmNrOfContextsReq | percentfail({pmNrOfContextsRej},{pmNrOfContextsReq}) | FLOAT | % | Seizure success rate of contexts by the VMGW. | ermgwmsbh |
| %_pmNrOfIpTermsReq | percentfail({pmNrOfIpTermsRej},{pmNrOfIpTermsReq}) | FLOAT | % | Termination success rate of IP requests in this VMGW. | ermgwmsbh |
| pmGcpNrOfReceivedMessages | ericsson_vmgw_utilisation_raw.pmgcpnrofreceivedmessages | INT8 | # | Total number of GCP messages which have been received | ermgwmsbh |
| pmGcpNrOfSentMessages | ericsson_vmgw_utilisation_raw.pmgcpnrofsentmessages | INT8 | # | Total number of GCP messages which have been sent by the VMGW | ermgwmsbh |
| pmGcpNrOfTimerRecovery | ericsson_vmgw_utilisation_raw.pmgcpnroftimerrecovery | INT8 | # | Obsolete in R4.1:Total number of timer recovery actions or events which have been implemented by the VMGw. | ermgwmsbh |
| pmGcpSystemUpTime | ericsson_vmgw_utilisation_raw.pmgcpsystemuptime | INT8 | seconds | Amount of time in seconds that the GCP link has been in operation. | ermgwmsbh |
| pmNrOfAal2TermsBusy | ericsson_vmgw_utilisation_raw.pmnrofaal2termsbusy | INT8 | # | Current number of AAL2 terminations in use in this VMGw. | ermgwmsbh |
| pmNrOfAal2TermsRej | ericsson_vmgw_utilisation_raw.pmnrofaal2termsrej | INT8 | # | Total number of unsuccessful AAL2 termination requests in this VMGw. | ermgwmsbh |
| pmNrOfAal2TermsReq | ericsson_vmgw_utilisation_raw.pmnrofaal2termsreq | INT8 | # | Total number of AAL2 termination requests in this VMGw. | ermgwmsbh |
| pmNrOfConnIcmpDestUnreachs | ericsson_vmgw_utilisation_2_raw.pmnrofconnicmpdestunreachs | INTEGER | # | The total number of connections with faults resulting from the reception of Internet Control Message Protocol( ICMP) Destination unreachable messages. | ermgwmsbh |
| pmNrOfContextsBusy | ericsson_vmgw_utilisation_raw.pmnrofcontextsbusy | INT8 | # | Number of busy contexts currently existing in the VMGw. | ermgwmsbh |
| pmNrOfContextsRej | ericsson_vmgw_utilisation_raw.pmnrofcontextsrej | INT8 | # | Number of context seizure request received from the MGC but rejected by the VMGw. | ermgwmsbh |
| pmNrOfContextsReq | ericsson_vmgw_utilisation_raw.pmnrofcontextsreq | INT8 | # | Number of context seizure requests received from the MGC by the VMGw. | ermgwmsbh |
| pmNrOfGcpNotifyCsdFaultAEst | ericsson_vmgw_utilisation_2_raw.pmnrofgcpnotifycsdfaultaest | INTEGER | # | The total number of encountered Circuit Switched Data (CSD) termination faults after bearer establishment (between establishment of bearer and reception of Gateway Control Protocol (GCP) Sub, resulting in the sending of a GCP Notify message towards the MGC. | ermgwmsbh |
| pmNrOfGcpNotifyCsdFaultBEst | ericsson_vmgw_utilisation_2_raw.pmnrofgcpnotifycsdfaultbest | INTEGER | # | The total number of encountered Circuit Switched Data (CSD) termination faults before bearer establishment (between sending of Gateway Control Protocol (GCP) AddReply and establishment of Iu/Nb bearer) for example due to protocol negotiation problems, resulting in the sending of a GCP Notify message towards the Media Gateway controller (MGC). | ermgwmsbh |
| pmNrOfGcpNotifySpeechFaultAEst | ericsson_vmgw_utilisation_2_raw.pmnrofgcpnotifyspeechfaultaest | INTEGER | # | The total number of encountered speech termination faults after bearer establishment (between establishment of bearer and reception of Gateway Control Protocol (GCP) Sub that result in the sending of a GCP Notify message towards the Media Gateway controller (MGC). | ermgwmsbh |
| pmNrOfGcpNotifySpeechFaultBEst | ericsson_vmgw_utilisation_2_raw.pmnrofgcpnotifyspeechfaultbest | INTEGER | # | The total number of encountered speech termination faults before bearer establishment (between sending of Gateway Control Protocol (GCP) AddReply and establishment of Iu/Nb bearer) for example due to protocol negotiation problems, resulting in the sending of a GCP Notify message towards the Media Gateway controller (MGC). | ermgwmsbh |
| pmNrOfGcpOctetsRec | ericsson_vmgw_utilisation_2_raw.pmnrofgcpoctetsrec | INT8 | Octets | The total number of octets in received Gateway Control Protocol (GCP H.248) messages. | ermgwmsbh |
| pmNrOfGcpOctetsSent | ericsson_vmgw_utilisation_2_raw.pmnrofgcpoctetssent | INT8 | Octets | The total number of octets in sent Gateway Control Protocol (GCP H.248) messages. | ermgwmsbh |
| pmNrOfGcpRetrans | ericsson_vmgw_utilisation_2_raw.pmnrofgcpretrans | INTEGER | # | The total number of Gateway Control Protocol (GCP) retransmissions sent to the Media Gateway Controller (MGC). | ermgwmsbh |
| pmNrOfGcpSentPendingMess | ericsson_vmgw_utilisation_2_raw.pmnrofgcpsentpendingmess | INTEGER | # | The total number of sent TransactionPending messages. | ermgwmsbh |
| pmNrOfGcpTransactionWithMaxRetr | ericsson_vmgw_utilisation_2_raw.pmnrofgcptransactionwithmaxretr | INTEGER | # | The total number of transaction releases where the maximum number of retransmissions was reached. | ermgwmsbh |
| pmNrOfGcpTransWithMaxPendingMess | ericsson_vmgw_utilisation_3_raw.pmnrofgcptranswithmaxpendingmess | INTEGER | # | The total number of transactions where the maximum number of TransactionPending messages was sent, leading to sending of a transaction fault towards the MediaGateway controller (MGC). | ermgwmsbh |
| pmNrOfInternalAal2ConnEstabFail | ericsson_vmgw_utilisation_3_raw.pmnrofinternalaal2connestabfail | INTEGER | # | The total number of ATM Adaptation Layer type 2 (AAL2) connection establishment failures for node internal connections. | ermgwmsbh |
| pmNrOfInvokedGcpLoadControl | ericsson_vmgw_utilisation_3_raw.pmnrofinvokedgcploadcontrol | INTEGER | # | The total number of occurrences that Gateway Control Protocol (GCP) load control service has been invoked towards the Media Gateway controller (MGC). | ermgwmsbh |
| pmNrOfIpTermsBusy | ericsson_vmgw_utilisation_raw.pmnrofiptermsbusy | INT8 | # | The current number of Internet Protocol (IP) terminations in use in this VMGw. | ermgwmsbh |
| pmNrOfIpTermsRej | ericsson_vmgw_utilisation_raw.pmnrofiptermsrej | INT8 | # | Total number of unsuccessful IP termination requests in this VMGw. | ermgwmsbh |
| pmNrOfIpTermsReq | ericsson_vmgw_utilisation_raw.pmnrofiptermsreq | INT8 | # | Total number of IP termination requests in this VMGw. | ermgwmsbh |
| pmNrOfIuTermAal2BearEstabFailLoc | ericsson_vmgw_utilisation_3_raw.pmnrofiutermaal2bearestabfailloc | INTEGER | # | The total number of terminating ATM Adaptation Layer type 2 (AAL2) bearer establishment failures on an Iu-interface due to a local reason. | ermgwmsbh |
| pmNrOfIuTermAal2BearEstabFailRem | ericsson_vmgw_utilisation_3_raw.pmnrofiutermaal2bearestabfailrem | INTEGER | # | The total number of terminating ATM Adaptation Layer type 2 (AAL2) bearer establishment failures on an Iu-interface due to a remote reason. | ermgwmsbh |
| pmNrOfNbOrigAal2BearEstabFailLoc | ericsson_vmgw_utilisation_3_raw.pmnrofnborigaal2bearestabfailloc | INTEGER | # | The total number of originating ATM Adaptation Layer type 2 (AAL2) bearer establishment failures on an Nb-interface due to a local reason. | ermgwmsbh |
| pmNrOfNbOrigAal2BearEstabFailRem | ericsson_vmgw_utilisation_3_raw.pmnrofnborigaal2bearestabfailrem | INTEGER | # | The total number of originating ATM Adaptation Layer type 2 (AAL2) bearer establishment failures on an Nb-interface due to a remote reason. | ermgwmsbh |
| pmNrOfNbTermAal2BearEstabFailLoc | ericsson_vmgw_utilisation_3_raw.pmnrofnbtermaal2bearestabfailloc | INTEGER | # | The total number of terminating ATM Adaptation Layer type 2 (AAL2) bearer establishment failures on an Nb-interface due to a local reason. | ermgwmsbh |
| pmNrOfNbTermAal2BearEstabFailRem | ericsson_vmgw_utilisation_3_raw.pmnrofnbtermaal2bearestabfailrem | INTEGER | # | The total number of terminating ATM Adaptation Layer type 2 (AAL2) bearer establishment failures on an Nb-interface due to a remote reason. | ermgwmsbh |
| pmNrOfTdmTermsFaulty | ericsson_vmgw_utilisation_raw.pmnroftdmtermsfaulty | INT8 | # | Current number of TDM termination groups in the Vmgw that are in operational state DISABLED. | ermgwmsbh |
| pmNrOfTdmTermsLocked | ericsson_vmgw_utilisation_raw.pmnroftdmtermslocked | INT8 | # | Current number of TDM Termination groups in the Vmgw that are in administrative state LOCKED. | ermgwmsbh |
| pmTotalNrOfTdmTerms | ericsson_vmgw_utilisation_raw.pmtotalnroftdmterms | INT8 | # | Current number of TDM Terminations configured for the Vmgw. | ermgwmsbh |
Virtual path data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmBwErrBlocks}) | FLOAT | % | ||
| pmBwErrBlocks | ericsson_vpctp_virtual_path_raw.pmbwerrblocks | INT8 | # | Total number of backward errored blocks. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmBwLostCells | ericsson_vpctp_virtual_path_raw.pmbwlostcells | INT8 | # | Total number of lost backward cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmBwMissinsCells | ericsson_vpctp_virtual_path_raw.pmbwmissinscells | INT8 | # | Total number of misinserted backward cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmFwErrBlocks | ericsson_vpctp_virtual_path_raw.pmfwerrblocks | INT8 | # | Total number of forward errored blocks. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmFwLostCells | ericsson_vpctp_virtual_path_raw.pmfwlostcells | INT8 | # | Total number of lost forward cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmFwMissinsCells | ericsson_vpctp_virtual_path_raw.pmfwmissinscells | INT8 | # | Total number of forward misinserted cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmLostBrCells | ericsson_vpctp_virtual_path_raw.pmlostbrcells | INT8 | # | Total number of lost backward reporting cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmLostFpmCells | ericsson_vpctp_virtual_path_raw.pmlostfpmcells | INT8 | # | Total number of lost Forward Performance Monitoring (FPM) cells. | eraputctbh, ermgwmsbh, ervpltcbh |
Data from VPCTP level aggregated up to VPLTP.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmBwErrBlocks}) | FLOAT | % | ||
| pmBwErrBlocks | ericsson_vpltp_tgfvpctp_raw.pmbwerrblocks | INT8 | # | Total number of backward errored blocks. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmBwLostCells | ericsson_vpltp_tgfvpctp_raw.pmbwlostcells | INT8 | # | Total number of lost backward cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmBwMissinsCells | ericsson_vpltp_tgfvpctp_raw.pmbwmissinscells | INT8 | # | Total number of misinserted backward cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmFwErrBlocks | ericsson_vpltp_tgfvpctp_raw.pmfwerrblocks | INT8 | # | Total number of forward errored blocks. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmFwLostCells | ericsson_vpltp_tgfvpctp_raw.pmfwlostcells | INT8 | # | Total number of lost forward cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmFwMissinsCells | ericsson_vpltp_tgfvpctp_raw.pmfwmissinscells | INT8 | # | Total number of forward misinserted cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmLostBrCells | ericsson_vpltp_tgfvpctp_raw.pmlostbrcells | INT8 | # | Total number of lost backward reporting cells. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmLostFpmCells | ericsson_vpltp_tgfvpctp_raw.pmlostfpmcells | INT8 | # | Total number of lost Forward Performance Monitoring (FPM) cells. | eraputctbh, ermgwmsbh, ervpltcbh |
Virtual path link traffic data
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({Tx_cells_per_second}) | FLOAT | % | ||
| Cer_Rx | ericsson_vpltp_traffic_2_raw.cer_rx | FLOAT | # | Cell error rate (received) | eraputctbh, ermgwmsbh, ervpltcbh |
| Cer_Tx | ericsson_vpltp_traffic_2_raw.cer_tx | FLOAT | # | Cell error rate (transmitted) | eraputctbh, ermgwmsbh, ervpltcbh |
| Clr_Rx | ericsson_vpltp_traffic_2_raw.clr_rx | FLOAT | # | Cell loss rate (received) | eraputctbh, ermgwmsbh, ervpltcbh |
| Clr_Tx | ericsson_vpltp_traffic_2_raw.clr_tx | FLOAT | # | Cell loss rate (transmitted) | eraputctbh, ermgwmsbh, ervpltcbh |
| Cmr_Rx | ericsson_vpltp_traffic_2_raw.cmr_rx | FLOAT | # | Cell misinsertion rate (received) | eraputctbh, ermgwmsbh, ervpltcbh |
| Cmr_Tx | ericsson_vpltp_traffic_2_raw.cmr_tx | FLOAT | # | Cell misinsertion rate (transmitted) | eraputctbh, ermgwmsbh, ervpltcbh |
| pmReceivedAtmCells | ericsson_vpltp_traffic_raw.pmreceivedatmcells | INT8 | # | Total number of ATM cells received through this Virtual Path (VP) link. | eraputctbh, ermgwmsbh, ervpltcbh |
| pmTransmittedAtmCells | ericsson_vpltp_traffic_raw.pmtransmittedatmcells | INT8 | # | Total number of ATM cells transmitted through this VP link. | eraputctbh, ermgwmsbh, ervpltcbh |
| Rx_bandwidth_per_second | ericsson_vpltp_traffic_raw.rx_bandwidth_per_second | FLOAT | # | The amount of received bandwidth per second | eraputctbh, ermgwmsbh, ervpltcbh |
| Rx_cells_per_second | ericsson_vpltp_traffic_raw.rx_cells_per_second | FLOAT | # | Received cells per second | eraputctbh, ermgwmsbh, ervpltcbh |
| Total_cells | ericsson_vpltp_traffic_raw.total_cells | INT8 | # | Total number of ATM cells transmitted and received through this VP link | eraputctbh, ermgwmsbh, ervpltcbh |
| Tx_bandwidth_per_second | ericsson_vpltp_traffic_raw.tx_bandwidth_per_second | FLOAT | # | The amount of transmitted bandwidth per second | eraputctbh, ermgwmsbh, ervpltcbh |
| Tx_cells_per_second | ericsson_vpltp_traffic_raw.tx_cells_per_second | FLOAT | # | Transmitted cells per second | eraputctbh, ermgwmsbh, ervpltcbh |
| Usage_rate_Rx | ericsson_vpltp_traffic_raw.usage_rate_rx | FLOAT | # | Usage rate received cells | eraputctbh, ermgwmsbh, ervpltcbh |
| Usage_rate_Tx | ericsson_vpltp_traffic_raw.usage_rate_tx | FLOAT | # | Usage rate transmitted cells | eraputctbh, ermgwmsbh, ervpltcbh |
VT15 terminating point data.
| KPI Name | Expression | Data Type | Units | Description | Additional Summaries |
|---|---|---|---|---|---|
| %_data_coverage | getvalidity({pmEs}) | FLOAT | % | ||
| pmEs | ericsson_vt15_vt15_terminating_point_raw.pmes | INT8 | seconds | Total number of Errored Seconds. | ermgwmsbh |
| pmSes | ericsson_vt15_vt15_terminating_point_raw.pmses | INT8 | seconds | Total number of Severely Errored Seconds. | ermgwmsbh |
| pmUas | ericsson_vt15_vt15_terminating_point_2_raw.pmuas | INTEGER | Seconds | Transmission Unavailable Seconds (SES). The accumulated unavailable time in seconds during the interval. Unavailable time starts when 10 consecutive SES are detected (them being part of the unavailable time) and ends when 10 consecutive non-SES are detected. | ermgwmsbh |
This section lists the hierarchy ("NC") tables that are included in this technology pack's database schema.
| Column Name | Data Type | Loader Block/Mapping |
|---|---|---|
| nc_id | SERIAL | n/a |
| aal2_sp_id | VARCHAR(50) | n/a |
| region_id | VARCHAR(255) | n/a |
| timestamp | INTEGER | n/a |
| endstamp | INTEGER | n/a |
| Column Name | Data Type | Loader Block/Mapping |
|---|---|---|
| nc_id | SERIAL | n/a |
| ip_protocol_layer_id | VARCHAR(50) | n/a |
| region_id | VARCHAR(50) | n/a |
| timestamp | INTEGER | n/a |
| endstamp | INTEGER | n/a |
| Column Name | Data Type | Loader Block/Mapping |
|---|---|---|
| nc_id | SERIAL | n/a |
| ms_processing_id | VARCHAR(50) | n/a |
| region_id | VARCHAR(50) | n/a |
| timestamp | INTEGER | n/a |
| endstamp | INTEGER | n/a |
| Column Name | Data Type | Loader Block/Mapping |
|---|---|---|
| nc_id | SERIAL | n/a |
| ospf_id | VARCHAR(80) | n/a |
| region_id | VARCHAR(50) | n/a |
| timestamp | INTEGER | n/a |
| endstamp | INTEGER | n/a |
| Column Name | Data Type | Loader Block/Mapping |
|---|---|---|
| nc_id | SERIAL | n/a |
| plug_in_unit_id | VARCHAR(80) | n/a |
| region_id | VARCHAR(50) | n/a |
| timestamp | INTEGER | n/a |
| endstamp | INTEGER | n/a |
| Column Name | Data Type | Loader Block/Mapping |
|---|---|---|
| nc_id | SERIAL | n/a |
| vpctp_id | VARCHAR(50) | n/a |
| atm_port_id | VARCHAR(50) | n/a |
| timestamp | INTEGER | n/a |
| endstamp | INTEGER | n/a |
| Column Name | Data Type | Loader Block/Mapping |
|---|---|---|
| nc_id | SERIAL | n/a |
| vpltp_id | VARCHAR(50) | n/a |
| atm_port_id | VARCHAR(50) | n/a |
| timestamp | INTEGER | n/a |
| endstamp | INTEGER | n/a |
This section lists the performance tables that are included in this technology pack's database schema, grouped by the network object to which they relate, as follows:
This section lists the views that are included in this technology pack's database schema.
Not applicable to this tech pack.